Content here
\")", "minLength": 1 }, "fileName": { "type": "string", "description": "Output filename (e.g. \"report.pdf\")" }, "options": { "type": "object", "properties": { "landscape": { "type": "boolean", "description": "Landscape orientation (default false)" }, "printBackground": { "type": "boolean", "description": "Render background colors and images (default true)" }, "displayHeaderFooter": { "type": "boolean", "description": "Show header/footer (default false)" }, "headerTemplate": { "type": "string", "description": "HTML template for page header" }, "footerTemplate": { "type": "string", "description": "HTML template for page footer" }, "paperWidth": { "type": "number", "description": "Page width in inches (default 8.27 for A4)" }, "paperHeight": { "type": "number", "description": "Page height in inches (default 11.69 for A4)" }, "marginTop": { "type": "number", "description": "Top margin in inches (default 0.4)" }, "marginBottom": { "type": "number", "description": "Bottom margin in inches (default 0.4)" } }, "description": "PDF rendering options (page size, margins, header/footer)" } }, "required": [ "html" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "document.pdf.from_url", "description": "Capture any web page URL as a PDF using headless Chrome with full JS rendering \u2014 perfect for archiving pages, generating reports from dashboards, or creating printable snapshots. Returns temporary PDF download URL (API2PDF)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to capture as PDF (e.g. \"https://example.com/report\")" }, "fileName": { "type": "string", "description": "Output filename (e.g. \"snapshot.pdf\")" }, "options": { "type": "object", "properties": { "landscape": { "type": "boolean", "description": "Landscape orientation (default false)" }, "printBackground": { "type": "boolean", "description": "Render background colors (default true)" }, "paperWidth": { "type": "number", "description": "Page width in inches" }, "paperHeight": { "type": "number", "description": "Page height in inches" } }, "description": "PDF rendering options" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "document.pdf.merge", "description": "Merge 2-20 PDF documents (provided as URLs) into a single combined PDF. Preserves page order. Returns temporary download URL for the merged result (API2PDF)", "inputSchema": { "type": "object", "properties": { "urls": { "type": "array", "items": { "type": "string" }, "description": "Ordered list of PDF URLs to merge (2-20 URLs)", "minItems": 2, "maxItems": 20 }, "fileName": { "type": "string", "description": "Output filename for merged PDF (e.g. \"combined.pdf\")" } }, "required": [ "urls" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.podcast.search", "description": "Search 4M+ podcasts by keyword \u2014 returns title, author, description, artwork, episode count, language, categories, RSS feed URL. Open directory covering all languages and countries (PodcastIndex)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search term or phrase (e.g. \"artificial intelligence\", \"Lex Fridman\", \"true crime\")", "minLength": 2 }, "max": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max results to return (default 20, max 100)" }, "lang": { "type": "string", "description": "Filter by language code (e.g. \"en\", \"de\", \"es\", \"ja\")" }, "cat": { "type": "string", "description": "Filter by category name (e.g. \"Technology\", \"News\", \"Comedy\", \"Business\")" } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.podcast.trending", "description": "Currently trending podcasts globally \u2014 ranked by recent episode engagement. Filter by language and category. Returns title, author, artwork, trending score, episode count (PodcastIndex)", "inputSchema": { "type": "object", "properties": { "max": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of trending podcasts (default 20, max 100)" }, "lang": { "type": "string", "description": "Filter by language code (e.g. \"en\")" }, "cat": { "type": "string", "description": "Filter by category (e.g. \"Technology\", \"News\")" }, "since": { "type": "integer", "description": "Unix timestamp \u2014 only include podcasts with new episodes since this time" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.podcast.episodes", "description": "List recent episodes for a podcast by feed ID \u2014 title, description, publish date, audio URL, duration, season/episode numbers. Use feed ID from search or trending results (PodcastIndex)", "inputSchema": { "type": "object", "properties": { "id": { "type": "integer", "description": "PodcastIndex feed ID (from search or trending results)" }, "max": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of episodes to return (default 20, max 100)" }, "since": { "type": "integer", "description": "Unix timestamp \u2014 only return episodes published after this time" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.podcast.details", "description": "Full metadata for a single podcast \u2014 title, author, description, RSS URL, artwork, language, categories, episode count, last update time, funding links (PodcastIndex)", "inputSchema": { "type": "object", "properties": { "id": { "type": "integer", "description": "PodcastIndex feed ID to retrieve full metadata for" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "address.geocodio.geocode", "description": "Forward geocode a US or Canada address to coordinates \u2014 returns lat/lng, parsed address components (street, city, state, ZIP, county), accuracy type (rooftop/range/street), and data source. USPS-standardized results with Census data (Geocodio)", "inputSchema": { "type": "object", "properties": { "address": { "type": "string", "description": "US or Canada address to geocode (e.g. \"1600 Pennsylvania Ave NW, Washington DC\", \"350 5th Ave, New York, NY 10118\")", "minLength": 3 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results to return (default 5, max 20)" } }, "required": [ "address" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "address.geocodio.reverse", "description": "Reverse geocode latitude/longitude to a US or Canada address \u2014 returns formatted address, parsed components (street, city, state, ZIP, county), accuracy type, and source. Supports multiple results ranked by proximity (Geocodio)", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude (24-72 range for US/Canada, e.g. 38.8976)", "minimum": 24, "maximum": 72 }, "lon": { "type": "number", "description": "Longitude (negative for Western Hemisphere, e.g. -77.0365)", "minimum": -180, "maximum": -50 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results to return (default 5, max 20)" } }, "required": [ "lat", "lon" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "business.hunter.company", "description": "Find professional email addresses and company data for any domain \u2014 organization name, industry, employee count, tech stack, social profiles, email pattern, and verified contact emails with confidence scores, positions, departments, seniority levels. 50M+ domains indexed (Hunter.io)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Company domain name (e.g. \"stripe.com\", \"google.com\", \"microsoft.com\")", "minLength": 3 }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max number of emails to return (default 10, max 100)" }, "department": { "type": "string", "enum": [ "executive", "finance", "hr", "it", "marketing", "operations", "sales", "legal", "management", "communication" ], "description": "Filter by department (e.g. \"engineering\", \"sales\", \"marketing\")" }, "type": { "type": "string", "enum": [ "personal", "generic" ], "description": "Filter by email type: \"personal\" (name@domain) or \"generic\" (info@domain)" } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "fdic.institutions.search", "description": "Search 4,300+ FDIC-insured US financial institutions by name, city, state, or charter type. Returns bank name, FDIC certificate number, total assets, deposits, and location. Official US Government data.", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Partial or full institution name to search (e.g. \"Chase\", \"Wells Fargo\")" }, "city": { "type": "string", "description": "City name filter (e.g. \"New York\", \"San Francisco\")" }, "state": { "type": "string", "description": "US state name filter (e.g. \"California\", \"New York\")" }, "charter_class": { "type": "string", "enum": [ "N", "SM", "NM", "SB", "OI" ], "description": "Charter type: N=national, SM=state member, NM=state nonmember, SB=savings bank, OI=OCC-supervised" }, "active": { "type": "boolean", "description": "Filter by active status. Default true (only active institutions)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results to return, max 50 (default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "fdic.institutions.details", "description": "Get full regulatory profile for an FDIC-insured bank by certificate number. Returns address, charter class, regulator, assets, deposits, branches, established date, insurance date, and coordinates.", "inputSchema": { "type": "object", "properties": { "cert": { "type": "integer", "description": "FDIC certificate number uniquely identifying the institution (obtain via fdic.search)" } }, "required": [ "cert" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "fdic.institutions.financials", "description": "Retrieve quarterly Call Report financial data for an FDIC-insured institution. Returns total assets, deposits, equity, net income, ROA, ROE, net interest margin, and efficiency ratio.", "inputSchema": { "type": "object", "properties": { "cert": { "type": "integer", "description": "FDIC certificate number for the institution" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of quarterly periods to return, max 20 (default 4)" } }, "required": [ "cert" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "fdic.institutions.failures", "description": "Query the FDIC failed bank list. Returns 4,100+ historical bank failures with failure date, assets at closure, acquiring institution, and estimated loss to the Deposit Insurance Fund. Covers all failures since 1934.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "Two-letter US state code filter (e.g. \"CA\", \"NY\", \"TX\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results to return, max 50 (default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "disease.covid.global", "description": "Get aggregated global COVID-19 statistics: total cases (704M+), deaths, recoveries, active cases, critical cases, cases/deaths per million, tests administered, and affected countries count. Data from Worldometers and OWID.", "inputSchema": { "type": "object", "properties": { "yesterday": { "type": "boolean", "description": "Return yesterday's data instead of today's (default false)" }, "twoDaysAgo": { "type": "boolean", "description": "Return data from two days ago for comparison (default false)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "disease.covid.country", "description": "Get COVID-19 statistics for a specific country by name or ISO code. Returns cases, deaths, recoveries, active, critical, per-million rates, tests, population, and flag. Covers 215+ countries and territories.", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Country name, ISO2 code, or ISO3 code (e.g. \"United States\", \"US\", \"USA\", \"Germany\", \"DE\")" }, "yesterday": { "type": "boolean", "description": "Return yesterday's data instead of today's (default false)" }, "strict": { "type": "boolean", "description": "Use strict name matching instead of fuzzy search (default false)" } }, "required": [ "country" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "disease.covid.history", "description": "Get historical time-series COVID-19 data for a country or globally. Returns daily case, death, and recovery counts. Useful for trend analysis and longitudinal research. Data from Johns Hopkins CSSE.", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Country name, ISO2/ISO3 code, or \"all\" for global aggregate (default \"all\")" }, "lastdays": { "type": "integer", "minimum": 1, "maximum": 1500, "description": "Number of most recent days to return (default 30, max ~1500 for full history)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "disease.influenza.cdc", "description": "Get US influenza surveillance data from CDC FluView. Returns weekly ILI (influenza-like illness) activity levels by age group, positive test rates by influenza type (A/B), and national summary. Updated weekly.", "inputSchema": { "type": "object", "properties": { "source": { "type": "string", "enum": [ "ilinet", "usil" ], "description": "Data source: \"ilinet\" for ILI network data or \"usil\" for US ILI summary (default \"ilinet\")" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "who.health.indicators", "description": "List 1,000+ WHO Global Health Observatory indicators: life expectancy, mortality rates, disease burden, immunization, nutrition, mental health, environmental health. Returns indicator codes for use with who.data.", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Keyword to filter indicators by name (e.g. \"mortality\", \"immunization\", \"life expectancy\", \"HIV\", \"malaria\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of indicators to return, max 100 (default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "who.health.data", "description": "Retrieve WHO health data for a specific indicator, optionally filtered by country and year range. Returns values for up to 194 countries spanning multiple decades. Official UN member state reporting data.", "inputSchema": { "type": "object", "properties": { "indicator": { "type": "string", "description": "WHO indicator code (e.g. \"WHOSIS_000001\" for life expectancy, \"MDG_0000000001\" for under-5 mortality). Get codes from who.indicators" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-3 country code (e.g. \"USA\", \"DEU\", \"BRA\", \"JPN\"). Omit for all countries" }, "year_from": { "type": "integer", "description": "Earliest year to include (e.g. 2000)" }, "year_to": { "type": "integer", "description": "Latest year to include (e.g. 2023)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of data points to return, max 100 (default 20)" } }, "required": [ "indicator" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "who.health.countries", "description": "List all 194 WHO member countries and territories with codes and names. Use returned country codes with who.data to filter health indicators by country.", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Partial country name to filter (e.g. \"United\", \"Germany\", \"Brazil\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Number of countries to return, max 200 (default 50)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gdacs.disasters.alerts", "description": "Get current and recent global disaster alerts from the UN GDACS system. Returns earthquakes, tropical cyclones, floods, volcanoes, droughts, and tsunamis with color-coded severity (Green/Orange/Red), affected country, coordinates, and population impact estimates.", "inputSchema": { "type": "object", "properties": { "event_type": { "type": "string", "enum": [ "EQ", "TC", "FL", "VO", "DR", "TS" ], "description": "Filter by disaster type: EQ=earthquake, TC=tropical cyclone, FL=flood, VO=volcano, DR=drought, TS=tsunami" }, "alert_level": { "type": "string", "enum": [ "Green", "Orange", "Red" ], "description": "Minimum alert level filter: Green (low), Orange (medium), Red (high impact)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of events to return, max 50 (default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gdacs.disasters.details", "description": "Get detailed information for a specific GDACS disaster event by ID. Returns event name, alert level with justification, affected population at each severity level, coordinates, geometry for mapping, source agency, and situation report links.", "inputSchema": { "type": "object", "properties": { "event_id": { "type": "integer", "description": "GDACS event ID (obtain via gdacs.alerts)" }, "event_type": { "type": "string", "enum": [ "EQ", "TC", "FL", "VO", "DR", "TS" ], "description": "Event type code: EQ=earthquake, TC=tropical cyclone, FL=flood, VO=volcano, DR=drought, TS=tsunami" } }, "required": [ "event_id", "event_type" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gdacs.disasters.history", "description": "Query the GDACS historical disaster archive from 2000 onwards. Filter by date range, event type, country, and alert level. Returns past earthquakes, cyclones, floods, and volcanoes for disaster frequency analysis and regional risk assessment.", "inputSchema": { "type": "object", "properties": { "date_from": { "type": "string", "description": "Start date in YYYY-MM-DD format (e.g. \"2024-01-01\")" }, "date_to": { "type": "string", "description": "End date in YYYY-MM-DD format (e.g. \"2024-12-31\")" }, "event_type": { "type": "string", "enum": [ "EQ", "TC", "FL", "VO", "DR", "TS" ], "description": "Filter by disaster type" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-3 country code (e.g. \"JPN\", \"PHL\", \"USA\", \"IDN\")" }, "alert_level": { "type": "string", "enum": [ "Green", "Orange", "Red" ], "description": "Minimum alert level filter" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of events to return, max 50 (default 10)" } }, "required": [ "date_from", "date_to" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "rateapi.lending.mortgage", "description": "Get AI-powered mortgage rate decision from 4,300+ US lenders. Returns recommended actions, current APR rates, estimated monthly payments, and confidence scores. Supports 30yr/15yr fixed and ARM products. Filter by state, amount, and credit tier.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Two-letter US state code (e.g. \"CA\", \"NY\", \"TX\")" }, "amount": { "type": "number", "minimum": 10000, "description": "Loan amount in USD (e.g. 400000 for a $400K mortgage)" }, "term_months": { "type": "integer", "description": "Loan term in months: 180 (15yr), 360 (30yr), or custom" }, "rate_type": { "type": "string", "enum": [ "fixed", "adjustable" ], "description": "Rate type: \"fixed\" or \"adjustable\" (ARM)" }, "intent": { "type": "string", "enum": [ "purchase", "refinance" ], "description": "Loan intent: \"purchase\" for buying or \"refinance\"" }, "credit_score": { "type": "string", "enum": [ "excellent", "good", "fair", "poor" ], "description": "Credit score tier for rate filtering" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "rateapi.lending.auto", "description": "Get auto loan rate decision for new and used vehicles from US lenders. Returns recommended financing actions, APR rates by term (24-72 months), and estimated monthly payments. Filter by vehicle type and credit tier.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Two-letter US state code" }, "amount": { "type": "number", "minimum": 1000, "description": "Loan amount in USD (e.g. 35000)" }, "term_months": { "type": "string", "enum": [ "24", "36", "48", "60", "72" ], "description": "Loan term: 24, 36, 48, 60, or 72 months" }, "vehicle_type": { "type": "string", "enum": [ "new", "used" ], "description": "Vehicle type: \"new\" or \"used\"" }, "credit_score": { "type": "string", "enum": [ "excellent", "good", "fair", "poor" ], "description": "Credit score tier" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "rateapi.lending.heloc", "description": "Get Home Equity Line of Credit (HELOC) rate decision. Returns current HELOC APR rates, recommended actions, and lender comparisons. Filter by combined loan-to-value ratio (CLTV), state, and credit score tier.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Two-letter US state code" }, "cltv": { "type": "number", "minimum": 0, "maximum": 95, "description": "Combined loan-to-value ratio (0-95)" }, "credit_score": { "type": "string", "enum": [ "excellent", "good", "fair", "poor" ], "description": "Credit score tier" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "rateapi.lending.personal", "description": "Get personal loan rate decision from US lenders. Returns recommended financing actions, APR rates by term and amount, and monthly payment estimates. Filter by loan amount, term, and credit score tier.", "inputSchema": { "type": "object", "properties": { "amount": { "type": "number", "minimum": 1000, "description": "Loan amount in USD (e.g. 10000)" }, "term_months": { "type": "string", "enum": [ "12", "24", "36", "48", "60" ], "description": "Loan term: 12, 24, 36, 48, or 60 months" }, "credit_score": { "type": "string", "enum": [ "excellent", "good", "fair", "poor" ], "description": "Credit score tier" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "twitter.tweets.search", "description": "Search Twitter/X tweets by keyword, hashtag, or advanced query. Returns tweet text, author info, engagement metrics (likes, retweets, replies, views), and timestamps. 96% cheaper than official X API. Covers recent tweets.", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query \u2014 keywords, hashtags, or advanced operators (e.g. \"AI agents\", \"#crypto\", \"from:elonmusk\")" }, "sort_order": { "type": "string", "enum": [ "recency", "relevancy" ], "description": "Sort order: \"recency\" for latest first, \"relevancy\" for most relevant (default recency)" }, "cursor": { "type": "string", "description": "Pagination cursor from previous response (for next page of results)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "twitter.users.profile", "description": "Get a Twitter/X user profile by username. Returns display name, bio, follower/following count, tweet count, verified status, profile image, location, and account creation date.", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "Twitter/X username without @ (e.g. \"elonmusk\", \"OpenAI\")" }, "user_id": { "type": "string", "description": "Twitter/X numeric user ID as alternative to username" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "twitter.users.followers", "description": "Get paginated follower list for a Twitter/X user. Returns follower profiles with username, display name, bio, follower count, and verified status. Supports cursor pagination.", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "Twitter/X username to get followers for (without @)" }, "cursor": { "type": "string", "description": "Pagination cursor from previous response" } }, "required": [ "username" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "twitter.trends.worldwide", "description": "Get current trending topics on Twitter/X. Filter by location using WOEID (Where On Earth ID). Returns trend name, search query, and rank. 1=worldwide, 23424977=US, 23424975=UK.", "inputSchema": { "type": "object", "properties": { "woeid": { "type": "integer", "description": "Where On Earth ID for location-specific trends (1=worldwide, 23424977=US, 23424975=UK, 23424856=Japan)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "currents.news.latest", "description": "Get latest breaking news from 70+ countries in 18+ languages. Returns full article text, author, source URL, and publication time. Filter by language, country, and category (technology, business, health, sports, science, finance, world).", "inputSchema": { "type": "object", "properties": { "language": { "type": "string", "description": "ISO 639-1 language code (e.g. \"en\", \"de\", \"fr\", \"ja\", \"zh\"). Default: all languages" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"US\", \"GB\", \"DE\", \"JP\")" }, "category": { "type": "string", "description": "News category filter (e.g. \"technology\", \"business\", \"health\", \"sports\", \"science\", \"entertainment\", \"finance\", \"world\")" }, "page_size": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Number of articles to return, max 200 (default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "currents.news.search", "description": "Search news articles by keyword across 70+ countries and 18+ languages. Returns full article text with Boolean operator support. Filter by language, country, category, and date range.", "inputSchema": { "type": "object", "properties": { "keywords": { "type": "string", "description": "Search keywords \u2014 supports Boolean operators (e.g. \"AI agents\", \"climate AND policy\")" }, "language": { "type": "string", "description": "ISO 639-1 language code (e.g. \"en\", \"es\", \"ar\")" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-2 country code" }, "start_date": { "type": "string", "description": "Start date in ISO 8601 format (e.g. \"2026-03-01T00:00:00+00:00\")" }, "end_date": { "type": "string", "description": "End date in ISO 8601 format" }, "page_size": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Number of articles to return, max 200 (default 10)" } }, "required": [ "keywords" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "currents.news.categories", "description": "List all 46 available news categories: technology, business, health, sports, science, entertainment, finance, world, politics, and more. Use to discover valid category values for filtering.", "inputSchema": { "type": "object", "properties": { "locale": { "type": "string", "description": "Response locale (default: en)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "iban.banking.validate", "description": "Validate an IBAN and retrieve associated bank info: BIC/SWIFT code, bank name, address, country, currency, and SEPA membership. Supports 80+ IBAN-enabled countries including EU, UK, and MENA. Returns validation result with detailed breakdown.", "inputSchema": { "type": "object", "properties": { "iban": { "type": "string", "description": "IBAN to validate (e.g. \"DE89370400440532013000\", \"GB29NWBK60161331926819\"). Spaces allowed, auto-stripped." } }, "required": [ "iban" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "iban.banking.calculate", "description": "Calculate a valid IBAN from domestic bank routing details: country code, bank code, account number, and optional branch code. Returns the computed IBAN with correct checksum. Useful for payment automation.", "inputSchema": { "type": "object", "properties": { "country_code": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"DE\", \"GB\", \"FR\", \"NL\")", "minLength": 2, "maxLength": 2 }, "bank_code": { "type": "string", "description": "Domestic bank code (e.g. \"37040044\" for Germany, \"NWBK\" for UK)" }, "account_number": { "type": "string", "description": "Account number in domestic format" }, "branch_code": { "type": "string", "description": "Branch/sort code if required by the country (e.g. \"601613\" for UK)" } }, "required": [ "country_code", "bank_code", "account_number" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "chemistry.pubchem.search", "description": "Search 100M+ chemical compounds by name, formula, or SMILES string. Returns CID, molecular formula, weight, IUPAC name, SMILES, InChI, XLogP, H-bond donors/acceptors, exact mass, and complexity. The largest public chemical database (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Compound name, formula, or SMILES string (e.g. \"aspirin\", \"C9H8O4\", \"CC(=O)OC1=CC=CC=C1C(=O)O\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Maximum results to return (1-20, default 5)" } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "chemistry.pubchem.properties", "description": "Get full physical and chemical properties for a compound by PubChem CID \u2014 molecular formula, weight, SMILES, InChI, InChIKey, XLogP, H-bond donors/acceptors, exact mass, topological polar surface area, complexity, charge, heavy atom count (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "cid": { "type": "integer", "description": "PubChem Compound ID (CID) \u2014 get from compound_search results" } }, "required": [ "cid" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "chemistry.pubchem.synonyms", "description": "Get all known names, CAS registry numbers, trade names, and identifiers for a chemical compound by PubChem CID. Returns up to 50 synonyms from a database of millions of name variants (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "cid": { "type": "integer", "description": "PubChem Compound ID (CID) \u2014 returns all known names, CAS numbers, trade names" } }, "required": [ "cid" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "chemistry.pubchem.hazards", "description": "Get GHS (Globally Harmonized System) hazard classification for a compound \u2014 signal words (Danger/Warning), hazard statements (H-codes), precautionary statements (P-codes), pictograms. Essential for chemical safety assessments (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "cid": { "type": "integer", "description": "PubChem Compound ID (CID) \u2014 returns GHS hazard classification, pictograms, signal words" } }, "required": [ "cid" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "chemistry.pubchem.bioassays", "description": "Get bioactivity assay results for a compound \u2014 active/inactive counts, tested targets, assay types. Shows how the compound performed in biological tests across thousands of assays (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "cid": { "type": "integer", "description": "PubChem Compound ID (CID) \u2014 returns bioactivity assay results (active/inactive counts, targets)" } }, "required": [ "cid" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "chemistry.pubchem.structure", "description": "Look up a compound by name or identifier and get its chemical structure representations \u2014 SMILES (isomeric + canonical), InChI, InChIKey, molecular formula, and molecular weight. Convert between chemical identifier formats (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Compound name or identifier (e.g. \"caffeine\", \"50-78-2\") \u2014 returns SMILES, InChI, InChIKey, formula" } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ev.charging.search", "description": "Search 300K+ EV charging stations worldwide by location, country, operator, connector type, and power level. Returns station address, GPS coordinates, connectors (Type 2, CCS, CHAdeMO), power kW, operator, status. Filter by min power for fast charging. Largest open EV charging database (Open Charge Map)", "inputSchema": { "type": "object", "properties": { "country_code": { "type": "string", "description": "ISO 2-letter country code to filter by (e.g. \"US\", \"GB\", \"DE\")" }, "latitude": { "type": "number", "description": "Latitude for location-based search (e.g. 51.5074)" }, "longitude": { "type": "number", "description": "Longitude for location-based search (e.g. -0.1278)" }, "distance": { "type": "number", "description": "Search radius in distance_unit (default KM)" }, "distance_unit": { "type": "string", "enum": [ "KM", "Miles" ], "description": "Distance unit: KM or Miles (default KM)" }, "operator_id": { "type": "integer", "description": "Filter by charging network operator ID" }, "connection_type_id": { "type": "integer", "description": "Filter by connector type (e.g. 25=Type 2, 33=CCS, 2=CHAdeMO)" }, "min_power_kw": { "type": "number", "description": "Minimum charger power in kW (e.g. 50 for fast charging)" }, "status_type_id": { "type": "integer", "description": "Filter by status (50=Operational, 100=Not Operational)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Maximum results to return (1-100, default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ev.charging.details", "description": "Get full details for a specific EV charging station by ID \u2014 address, GPS coordinates, all connectors with type/power/status, network operator, usage cost, verification date, number of charging points. Use station ID from search or nearby results (Open Charge Map)", "inputSchema": { "type": "object", "properties": { "id": { "type": "integer", "description": "Open Charge Map station ID \u2014 get from search or nearby results" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ev.charging.nearby", "description": "Find the nearest EV charging stations to GPS coordinates within a radius (default 5km). Returns stations sorted by distance with connector types, power levels, and availability status. Filter by minimum power kW and connector type for DC fast charging (Open Charge Map)", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "GPS latitude of your location (e.g. 40.7128)" }, "longitude": { "type": "number", "description": "GPS longitude of your location (e.g. -74.0060)" }, "radius": { "type": "number", "description": "Search radius in KM (default 5)" }, "min_power_kw": { "type": "number", "description": "Minimum charger power in kW (e.g. 50 for DC fast charging)" }, "connection_type_id": { "type": "integer", "description": "Filter by connector type (25=Type 2, 33=CCS, 2=CHAdeMO)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Maximum results (1-50, default 10)" } }, "required": [ "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "security.ipqs.ip_check", "description": "Check any IP address for fraud signals \u2014 proxy, VPN, Tor, bot, crawler detection with fraud score (0-100). Returns geolocation (country, city, ISP, ASN), abuse velocity, connection type, and 9+ risk indicators. Essential for e-commerce fraud prevention (IPQualityScore)", "inputSchema": { "type": "object", "properties": { "ip": { "type": "string", "description": "IPv4 or IPv6 address to check (e.g. \"8.8.8.8\", \"2001:4860:4860::8888\")" }, "strictness": { "type": "integer", "minimum": 0, "maximum": 3, "description": "Detection strictness 0-3 (0=least strict, 3=most aggressive). Higher catches more fraud but may flag legitimate users" }, "allow_public_access_points": { "type": "boolean", "description": "Allow public WiFi/library IPs to pass without penalty (default false)" } }, "required": [ "ip" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "security.ipqs.email_check", "description": "Validate email for fraud risk \u2014 checks deliverability, disposable/temporary providers, honeypot traps, spam traps, leaked credentials, catch-all detection. Returns fraud score (0-100), SMTP verification, domain age, and abuse history. Goes beyond basic validation (IPQualityScore)", "inputSchema": { "type": "object", "properties": { "email": { "type": "string", "description": "Email address to validate and check for fraud (e.g. \"user@example.com\")" }, "fast": { "type": "boolean", "description": "Skip SMTP verification for faster response (default false)" }, "abuse_strictness": { "type": "integer", "minimum": 0, "maximum": 2, "description": "Abuse detection sensitivity 0-2 (0=low, 2=aggressive)" } }, "required": [ "email" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "security.ipqs.url_check", "description": "Scan any URL for malware, phishing, suspicious content, adult content, spamming, and domain parking. Returns risk score (0-100), domain reputation, domain age, IP address, HTTP status. Protects agents from visiting malicious URLs (IPQualityScore)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "Full URL to scan for malware, phishing, and threats (e.g. \"https://example.com/page\")" }, "strictness": { "type": "integer", "minimum": 0, "maximum": 2, "description": "Scanning strictness 0-2 (0=least strict, 2=most aggressive)" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "security.ipqs.phone_check", "description": "Check phone number for fraud risk \u2014 detects VOIP, prepaid, risky numbers, carrier info, line type (mobile/landline/VOIP), active status, leaked data. Returns fraud score (0-100) and geographic location. Supports international numbers with country filter (IPQualityScore)", "inputSchema": { "type": "object", "properties": { "phone": { "type": "string", "description": "Phone number to check in E.164 or national format (e.g. \"+12125551234\", \"2125551234\")" }, "country": { "type": "string", "description": "ISO 2-letter country code for national format numbers (e.g. \"US\", \"GB\")" }, "strictness": { "type": "integer", "minimum": 0, "maximum": 2, "description": "Fraud detection strictness 0-2" } }, "required": [ "phone" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.chem.resolve", "description": "Convert any chemical identifier to SMILES, InChI, and InChIKey. Input a compound name (e.g. \"aspirin\"), CAS number (e.g. \"50-78-2\"), SMILES, or InChIKey and get all other representations. The only universal chemical ID converter \u2014 essential for chemistry workflows and cross-database lookups (NCI CACTUS)", "inputSchema": { "type": "object", "properties": { "identifier": { "type": "string", "description": "Chemical identifier to resolve \u2014 compound name (e.g. \"aspirin\", \"caffeine\"), CAS number (e.g. \"50-78-2\"), SMILES (e.g. \"CC(=O)Oc1ccccc1C(O)=O\"), or InChIKey (e.g. \"BSYNRYMUTXBXSQ-UHFFFAOYSA-N\")", "minLength": 1 }, "output": { "type": "string", "enum": [ "all", "smiles", "stdinchi", "stdinchikey" ], "description": "Output format: \"all\" (SMILES + InChI + InChIKey), \"smiles\" (canonical SMILES only), \"stdinchi\" (Standard InChI only), \"stdinchikey\" (InChIKey only). Default: \"all\"", "default": "all" } }, "required": [ "identifier" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.chem.formula", "description": "Get molecular formula and molecular weight for any compound by name, CAS number, or SMILES. Returns formula (e.g. \"C9H8O4\" for aspirin) and weight in daltons (e.g. 180.157). Accepts any chemical identifier format (NCI CACTUS)", "inputSchema": { "type": "object", "properties": { "identifier": { "type": "string", "description": "Chemical identifier \u2014 compound name (e.g. \"ibuprofen\"), CAS number (e.g. \"15687-27-1\"), or SMILES string. Returns molecular formula and weight", "minLength": 1 } }, "required": [ "identifier" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.chem.names", "description": "Get all known names, synonyms, CAS numbers, and registry IDs for a chemical compound. Input any identifier (name, CAS, SMILES, InChIKey) and get the full list of aliases. Useful for finding alternative names, trade names, and cross-references (NCI CACTUS)", "inputSchema": { "type": "object", "properties": { "identifier": { "type": "string", "description": "Chemical identifier to look up synonyms for \u2014 compound name, CAS number, SMILES, or InChIKey (e.g. \"aspirin\", \"50-78-2\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Maximum number of names/synonyms to return (1-100). Default: 20", "default": 20 } }, "required": [ "identifier" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "vehicle.safety.recalls", "description": "Search NHTSA vehicle recalls by make, model, and year. Returns campaign number, manufacturer, subject, summary, consequence, remedy, affected components, and units affected. Covers all US recalls from 1966 to present. Essential for automotive safety, insurance, and fleet management agents (NHTSA)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Vehicle manufacturer name (e.g. \"Toyota\", \"Ford\", \"Tesla\", \"BMW\")", "minLength": 1 }, "model": { "type": "string", "description": "Vehicle model name (e.g. \"Camry\", \"Model 3\", \"F-150\", \"X5\")", "minLength": 1 }, "model_year": { "type": "integer", "description": "Model year (e.g. 2023). NHTSA recall data available from 1966 to present", "minimum": 1966, "maximum": 2030 } }, "required": [ "make", "model", "model_year" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "vehicle.safety.complaints", "description": "Search consumer complaints filed with NHTSA about vehicles. Returns incident details including crash/fire flags, injuries, deaths, affected components, and complaint summary. Covers US vehicles from ~1995 to present. Critical for safety research and product liability analysis (NHTSA)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Vehicle manufacturer name (e.g. \"Toyota\", \"Ford\", \"Tesla\", \"Honda\")", "minLength": 1 }, "model": { "type": "string", "description": "Vehicle model name (e.g. \"Camry\", \"Model 3\", \"Civic\")", "minLength": 1 }, "model_year": { "type": "integer", "description": "Model year (e.g. 2023). NHTSA complaint data available from ~1995 to present", "minimum": 1995, "maximum": 2030 } }, "required": [ "make", "model", "model_year" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "vehicle.safety.ratings", "description": "Get NCAP 5-Star crash test safety ratings by make/model/year or vehicle ID. Returns overall rating, frontal crash, side crash, and rollover ratings (1-5 stars). Also shows related complaints, recalls, and investigation counts. Available from ~2011 for US-market vehicles (NHTSA)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Vehicle manufacturer name (e.g. \"Toyota\", \"Honda\"). Required unless vehicle_id is provided" }, "model": { "type": "string", "description": "Vehicle model name (e.g. \"Camry\", \"Civic\"). Required unless vehicle_id is provided" }, "model_year": { "type": "integer", "minimum": 2011, "maximum": 2030, "description": "Model year (e.g. 2023). 5-Star ratings available from ~2011. Required unless vehicle_id is provided" }, "vehicle_id": { "type": "integer", "description": "NHTSA Vehicle ID for full ratings detail (get from initial search). Overrides make/model/year if provided" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "vehicle.safety.investigations", "description": "Search NHTSA defect investigation records by manufacturer and model. Returns investigation number, type (preliminary/engineering analysis), description, latest activity date, and NHTSA action number. Covers active and closed investigations for US vehicles (NHTSA)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Vehicle manufacturer name (e.g. \"Tesla\", \"GM\", \"Ford\")", "minLength": 1 }, "model": { "type": "string", "description": "Vehicle model name to narrow results (e.g. \"Model 3\", \"Bolt EV\")" } }, "required": [ "make" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.pdb.search", "description": "Search 220K+ macromolecular 3D structures in the Protein Data Bank by keyword, protein name, organism, or author. Returns PDB IDs with relevance scores. The canonical database for structural biology, X-ray crystallography, cryo-EM, and NMR structures (RCSB PDB)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query \u2014 keyword, protein name, organism, or author (e.g. \"insulin\", \"hemoglobin\", \"Homo sapiens\", \"Watson\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Maximum number of results (1-50). Default: 10", "default": 10 } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.pdb.structure", "description": "Get full details for a 3D protein structure by PDB ID \u2014 title, experimental method (X-ray/cryo-EM/NMR), resolution, molecular weight, chain counts (protein/DNA/RNA), deposit date, primary citation with DOI and PubMed ID. Essential for drug design and structural analysis (RCSB PDB)", "inputSchema": { "type": "object", "properties": { "pdb_id": { "type": "string", "description": "4-character PDB identifier (e.g. \"4HHB\" for hemoglobin, \"1BNA\" for DNA, \"6LU7\" for SARS-CoV-2 main protease)", "minLength": 4, "maxLength": 4 } }, "required": [ "pdb_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.pdb.ligand", "description": "Get chemical component data for a ligand/small molecule by its 3-letter PDB code \u2014 name, molecular formula, weight, type, formal charge, heavy atom count, SMILES/InChI descriptors. Covers ATP, HEM, NAG, drug molecules, cofactors, ions, and 40K+ chemical entities in the PDB (RCSB PDB)", "inputSchema": { "type": "object", "properties": { "ligand_id": { "type": "string", "description": "Chemical component identifier \u2014 standard 3-letter code (e.g. \"ATP\" for adenosine triphosphate, \"HEM\" for heme, \"NAG\" for N-acetylglucosamine, \"ZN\" for zinc ion)", "minLength": 1, "maxLength": 5 } }, "required": [ "ligand_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.pdb.sequence", "description": "Search protein structures by amino acid sequence similarity (BLAST). Input a protein sequence and find all PDB structures with matching chains. Configure identity cutoff (e.g. 90%) and E-value threshold. Returns PDB entity IDs ranked by similarity score. Essential for homology modeling and structure prediction (RCSB PDB)", "inputSchema": { "type": "object", "properties": { "sequence": { "type": "string", "description": "Protein amino acid sequence in one-letter code (e.g. \"MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH\" \u2014 first 50 residues of human hemoglobin alpha)", "minLength": 10 }, "identity_cutoff": { "type": "number", "minimum": 0.1, "maximum": 1, "description": "Minimum sequence identity (0.1-1.0). Default: 0.9 (90% identical)", "default": 0.9 }, "evalue_cutoff": { "type": "number", "description": "Maximum E-value threshold for BLAST significance. Default: 0.1", "default": 0.1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Maximum number of results (1-50). Default: 10", "default": 10 } }, "required": [ "sequence" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.adzuna.search", "description": "Search job listings across 16+ countries (US, UK, AU, CA, DE, FR, and more) by keyword, location, category, salary range. Returns job title, company, salary, location, and apply URL. 70K+ developer jobs in US alone (Adzuna)", "inputSchema": { "type": "object", "properties": { "what": { "type": "string", "description": "Job search keywords (e.g. \"python developer\", \"marketing manager\", \"nurse\")" }, "where": { "type": "string", "description": "Location (e.g. \"new york\", \"london\", \"berlin\")" }, "country": { "type": "string", "description": "Country code: us, gb, au, ca, de, fr, nl, in, br, pl, nz, za, sg, at, ch, it, ru (default us)", "default": "us" }, "category": { "type": "string", "description": "Job category tag (e.g. \"it-jobs\", \"sales-jobs\", \"engineering-jobs\"). Get tags from adzuna.categories" }, "salary_min": { "type": "number", "description": "Minimum salary filter" }, "salary_max": { "type": "number", "description": "Maximum salary filter" }, "full_time": { "type": "boolean", "description": "Filter full-time jobs only" }, "permanent": { "type": "boolean", "description": "Filter permanent jobs only" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results (1-20, default 10)", "default": 10 }, "page": { "type": "integer", "minimum": 1, "description": "Page number", "default": 1 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.adzuna.categories", "description": "List all job categories available in a country \u2014 IT, Sales, Engineering, HR, Healthcare, Hospitality, and more. Use category tags to filter adzuna.search results (Adzuna)", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Country code (default us)", "default": "us" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.adzuna.salary", "description": "Get salary distribution for a job title \u2014 returns histogram of salary buckets with job counts. Example: \"python developer\" in US \u2192 $20K-$140K distribution. Use for salary benchmarking and market research (Adzuna)", "inputSchema": { "type": "object", "properties": { "what": { "type": "string", "description": "Job title or keywords for salary histogram (e.g. \"python developer\", \"data scientist\")" }, "where": { "type": "string", "description": "Location for salary data" }, "country": { "type": "string", "description": "Country code (default us)", "default": "us" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "sports.bdl.games", "description": "Get NBA and NFL game results by date \u2014 scores, teams, status (Final/In Progress/Scheduled). Filter by date, season, or team. Covers all NBA and NFL games with real-time scores (BallDontLie)", "inputSchema": { "type": "object", "properties": { "date": { "type": "string", "description": "Game date (YYYY-MM-DD, e.g. \"2026-03-29\"). Returns all games on that date" }, "season": { "type": "integer", "description": "Season year (e.g. 2025 for 2025-26 season)" }, "team_id": { "type": "integer", "description": "Filter by team ID (get IDs from bdl.teams)" }, "sport": { "type": "string", "enum": [ "nba", "nfl" ], "description": "Sport league: \"nba\" (default) or \"nfl\"", "default": "nba" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "sports.bdl.teams", "description": "List NBA and NFL teams with conference, division, city, and abbreviation. Filter by conference (East/West for NBA, AFC/NFC for NFL) or division (BallDontLie)", "inputSchema": { "type": "object", "properties": { "conference": { "type": "string", "description": "Filter by conference (e.g. \"East\", \"West\" for NBA; \"AFC\", \"NFC\" for NFL)" }, "division": { "type": "string", "description": "Filter by division (e.g. \"Atlantic\", \"Pacific\" for NBA)" }, "sport": { "type": "string", "enum": [ "nba", "nfl" ], "description": "Sport league: \"nba\" (default) or \"nfl\"", "default": "nba" }, "limit": { "type": "integer", "minimum": 1, "maximum": 30, "description": "Max results (1-30, default 30)", "default": 30 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "sports.bdl.players", "description": "Search NBA players by name \u2014 returns position, jersey number, and current team. Example: \"lebron\" \u2192 LeBron James #23 F, Los Angeles Lakers (BallDontLie)", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Search by player name (e.g. \"lebron\", \"curry\", \"mahomes\")" }, "team_id": { "type": "integer", "description": "Filter by team ID" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "address.postal.lookup", "description": "Look up a postal/ZIP code in 60+ countries \u2014 returns city name, state/region, and lat/lon coordinates. Supports US, UK, Germany, France, Japan, Brazil, India, Australia, and 50+ more countries. Provide country code (ISO 2-letter) + postal code (Zippopotam.us)", "inputSchema": { "type": "object", "properties": { "country_code": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"us\", \"de\", \"gb\", \"fr\", \"jp\", \"br\", \"in\", \"au\"). Supports 60+ countries", "minLength": 2, "maxLength": 2 }, "postal_code": { "type": "string", "description": "Postal/ZIP code (e.g. \"90210\" for US, \"10115\" for Germany, \"SW1A\" for UK, \"75001\" for France)", "minLength": 1 } }, "required": [ "country_code", "postal_code" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "logistics.dhl.track", "description": "Track a DHL shipment by tracking number \u2014 returns current status, delivery events timeline, origin/destination, estimated delivery date, and service type. Supports all DHL services: Express, Parcel, eCommerce, Freight. Official DHL data for 220+ countries (DHL)", "inputSchema": { "type": "object", "properties": { "tracking_number": { "type": "string", "description": "DHL tracking number (e.g. \"00340434292135100186\" for DHL Paket, \"1234567890\" for DHL Express). Supports all DHL services: Express, Parcel, eCommerce, Freight", "minLength": 1 } }, "required": [ "tracking_number" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "address.ukpost.lookup", "description": "Look up a UK postcode \u2014 returns district, region, country, ward, parish, parliamentary constituency, and lat/lon coordinates. Backed by ONS/Ordnance Survey data. Example: \"SW1A 1AA\" \u2192 Westminster, London (Postcodes.io)", "inputSchema": { "type": "object", "properties": { "postcode": { "type": "string", "description": "UK postcode to look up (e.g. \"SW1A 1AA\" for Westminster, \"EC2R 8AH\" for City of London, \"M1 1AA\" for Manchester). Returns district, region, country, lat/lon, parliamentary constituency", "minLength": 1 } }, "required": [ "postcode" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "address.ukpost.nearest", "description": "Find nearest UK postcodes to a lat/lon coordinate \u2014 returns postcodes sorted by distance with district info. Use for reverse geocoding in the UK (Postcodes.io)", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude (e.g. 51.5074 for London)" }, "lon": { "type": "number", "description": "Longitude (e.g. -0.1278 for London)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 10, "description": "Max results (1-10, default 5)", "default": 5 } }, "required": [ "lat", "lon" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "address.ukpost.validate", "description": "Check if a UK postcode is valid and exists \u2014 returns true/false. Use for form validation or data cleaning (Postcodes.io)", "inputSchema": { "type": "object", "properties": { "postcode": { "type": "string", "description": "UK postcode to validate (e.g. \"SW1A 1AA\"). Returns true if valid format and exists", "minLength": 1 } }, "required": [ "postcode" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "logistics.shipengine.rates", "description": "Compare shipping rates across multiple carriers (USPS, UPS, FedEx, DHL) for a package. Provide origin/destination ZIP codes, weight in pounds, and optional dimensions. Returns sorted rates with price, delivery time, and service type. Up to 84% off retail rates (ShipEngine)", "inputSchema": { "type": "object", "properties": { "from_zip": { "type": "string", "description": "Origin US ZIP code (e.g. \"10001\" for NYC)", "minLength": 1 }, "to_zip": { "type": "string", "description": "Destination US ZIP code (e.g. \"90210\" for Beverly Hills)", "minLength": 1 }, "weight_lb": { "type": "number", "description": "Package weight in pounds (e.g. 5)", "minimum": 0.1 }, "length": { "type": "number", "description": "Package length in inches" }, "width": { "type": "number", "description": "Package width in inches" }, "height": { "type": "number", "description": "Package height in inches" }, "from_country": { "type": "string", "description": "Origin country code (default US)", "default": "US" }, "to_country": { "type": "string", "description": "Destination country code (default US)", "default": "US" } }, "required": [ "from_zip", "to_zip", "weight_lb" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "logistics.shipengine.validate", "description": "Validate and standardize a US address \u2014 returns USPS-verified address with corrected spelling, ZIP+4, and validation status. Catches typos, missing info, and invalid addresses before shipping (ShipEngine)", "inputSchema": { "type": "object", "properties": { "address_line1": { "type": "string", "description": "Street address (e.g. \"1 E 161 St\")", "minLength": 1 }, "address_line2": { "type": "string", "description": "Apartment, suite, unit (e.g. \"Apt 4B\")" }, "city": { "type": "string", "description": "City name (e.g. \"Bronx\")" }, "state": { "type": "string", "description": "State code (e.g. \"NY\")" }, "postal_code": { "type": "string", "description": "ZIP code (e.g. \"10451\")" }, "country": { "type": "string", "description": "Country code (default US)", "default": "US" } }, "required": [ "address_line1" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "logistics.shipengine.carriers", "description": "List all connected shipping carriers with their IDs and codes. Shows which carriers are available for rate comparison (USPS, UPS, FedEx, DHL, etc.) (ShipEngine)", "inputSchema": { "type": "object", "properties": { "filter": { "type": "string", "description": "Optional filter on carrier name (e.g. \"ups\", \"usps\"). Returns all connected carriers if omitted" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "weather.weatherapi.current", "description": "Get current weather conditions for any location worldwide \u2014 temperature, wind, humidity, pressure, UV index, cloud cover, feels-like temp. Accepts city name, coordinates, zip code, or airport code. 100K+ stations globally (WeatherAPI.com)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Location query \u2014 city name (e.g. \"London\"), coordinates (\"48.8,2.35\"), US zip (\"10001\"), UK postcode (\"SW1\"), IP address, or IATA airport code (\"JFK\")", "minLength": 1 } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "weather.weatherapi.forecast", "description": "Get 3-day weather forecast \u2014 daily min/max temperature, conditions, wind, precipitation, humidity, rain/snow chance, UV index. Accepts any location query (WeatherAPI.com)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Location query \u2014 city name, coordinates, zip code, or airport code", "minLength": 1 }, "days": { "type": "integer", "minimum": 1, "maximum": 3, "description": "Forecast days (1-3, default 3)", "default": 3 } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "weather.weatherapi.astronomy", "description": "Get sunrise, sunset, moonrise, moonset times and moon phase for any location and date. Returns moon illumination percentage and phase name (WeatherAPI.com)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Location query \u2014 city name, coordinates, or zip code", "minLength": 1 }, "date": { "type": "string", "description": "Date for astronomy data (YYYY-MM-DD, default today)" } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "weather.weatherapi.search", "description": "Search and autocomplete location names \u2014 returns matching cities with coordinates. Type partial name (e.g. \"lon\" \u2192 London, \"mos\" \u2192 Moscow). Use result coordinates with other weather tools (WeatherAPI.com)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search query \u2014 partial city name for autocomplete (e.g. \"lon\" \u2192 London, \"mos\" \u2192 Moscow)", "minLength": 1 } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "dev.code.execute", "description": "Execute source code in a sandboxed environment \u2014 71 programming languages supported (Python, JavaScript, Java, C++, Go, Rust, C#, Bash, Ruby, PHP, and 60+ more). Returns stdout, stderr, execution time, and memory usage. Safe sandboxed execution with CPU/memory limits. Use code.languages to get language IDs (Judge0 CE)", "inputSchema": { "type": "object", "properties": { "language_id": { "type": "integer", "description": "Language ID from code.languages (e.g. 71=Python 3, 63=JavaScript, 62=Java, 54=C++, 60=Go, 73=Rust, 51=C#, 46=Bash). Call code.languages for full list" }, "source_code": { "type": "string", "description": "Source code to execute", "minLength": 1 }, "stdin": { "type": "string", "description": "Standard input to feed to the program" }, "cpu_time_limit": { "type": "number", "description": "CPU time limit in seconds (default 5, max 15)" }, "memory_limit": { "type": "number", "description": "Memory limit in KB (default 128000 = 128MB)" } }, "required": [ "language_id", "source_code" ] }, "annotations": { "readOnlyHint": false, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "dev.code.languages", "description": "List all 71 available programming languages and their IDs for code execution. Common IDs: 71=Python 3.8, 63=JavaScript (Node.js), 62=Java, 54=C++ (GCC), 60=Go, 73=Rust, 51=C#, 46=Bash. Returns full list with compiler/interpreter versions (Judge0 CE)", "inputSchema": { "type": "object", "properties": { "filter": { "type": "string", "description": "Optional filter \u2014 substring match on language name (e.g. \"python\", \"java\", \"rust\"). Returns all 71 languages if omitted" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "web.scrape.extract", "description": "Extract raw HTML from any URL \u2014 cheapest web scraping API ($0.00013 for simple sites). Returns decoded HTML content, HTTP status code, and content length. Use for data extraction, content analysis, or price monitoring. Handles anti-bot protection automatically (Zyte)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to scrape \u2014 returns raw HTML content. Fast and cheap ($0.00013 for simple sites). Example: \"https://example.com\"" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "web.scrape.browser", "description": "Render a URL with headless browser and return JS-rendered HTML. Use for SPAs, React/Vue apps, or pages with dynamic content that raw HTTP cannot capture. Returns fully rendered DOM as HTML text (Zyte)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to render with headless browser \u2014 returns JS-rendered HTML. Use for SPAs, dynamic content. More expensive than extract. Example: \"https://example.com\"" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "web.scrape.screenshot", "description": "Capture a full-page screenshot of any URL \u2014 returns base64-encoded PNG image. Use for visual verification, monitoring, or archiving. Headless browser renders the page before capture (Zyte)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to screenshot \u2014 returns base64-encoded PNG image. Use for visual verification or page capture. Example: \"https://example.com\"" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "vehicle.carmarket.search", "description": "Search millions of active US car listings by make, model, year, price range, mileage, ZIP code, and radius. Returns VIN, price, miles, dealer info, Carfax status, and days on market. Filter by seller type (dealer/private) and color. Data from all major US marketplaces (MarketCheck)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Car manufacturer (e.g. \"Toyota\", \"Honda\", \"BMW\", \"Tesla\")" }, "model": { "type": "string", "description": "Car model (e.g. \"Camry\", \"Civic\", \"Model 3\")" }, "year": { "type": "integer", "description": "Model year (e.g. 2023, 2024)" }, "price_min": { "type": "number", "description": "Minimum price in USD" }, "price_max": { "type": "number", "description": "Maximum price in USD" }, "miles_max": { "type": "number", "description": "Maximum mileage" }, "zip": { "type": "string", "description": "US ZIP code to search near (e.g. \"10001\")" }, "radius": { "type": "number", "description": "Search radius in miles from ZIP (max 100 on free tier)" }, "seller_type": { "type": "string", "enum": [ "dealer", "private" ], "description": "Filter by seller type" }, "exterior_color": { "type": "string", "description": "Filter by exterior color (e.g. \"White\", \"Black\", \"Red\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 }, "start": { "type": "integer", "minimum": 0, "description": "Offset for pagination" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "vehicle.carmarket.listing", "description": "Get full details for a specific car listing by ID \u2014 VIN, price, MSRP, mileage, full build specs (engine, transmission, drivetrain, fuel type), dealer contact, Carfax 1-owner status, days on market, photos. Get listing IDs from carmarket.search (MarketCheck)", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "MarketCheck listing ID (e.g. \"3TMCZ5AN5PM564843-883937ce-f335\"). Get IDs from carmarket.search results", "minLength": 1 } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "security.threatintel.reputation", "description": "Get domain reputation score (0-100) with detailed security test results \u2014 WHOIS age, SSL validity, mail server config, blacklist status, and more. Higher score = safer domain. Essential for security agents evaluating domain trustworthiness (Threat Intelligence Platform)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to check reputation (e.g. \"google.com\", \"suspicious-site.xyz\"). Returns reputation score 0-100 and security test results", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "security.threatintel.malware", "description": "Check if a domain is associated with malware, phishing, or other threats. Returns safe score (0-100) and detailed warning descriptions. Use for URL safety verification before agent navigation (Threat Intelligence Platform)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to check for malware and phishing (e.g. \"example.com\"). Returns safe score 0-100 and warning details", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "security.threatintel.infrastructure", "description": "Analyze domain infrastructure \u2014 all associated IPv4 addresses, geolocation (country, city, region), subnets, and resource types (web, mail, DNS). Reveals hosting setup, CDN usage, and geographic distribution (Threat Intelligence Platform)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to analyze infrastructure (e.g. \"google.com\"). Returns all associated IPs, geolocation, subnets, and resource types", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "podcasts.listennotes.search", "description": "Full-text search across 3.7M+ podcasts and 186M+ episodes. Search by keyword, filter by language and genre, sort by relevance or date. Returns episode titles, podcast names, audio URLs, and duration. The most comprehensive podcast search API available (Listen Notes)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search query \u2014 full-text search across 186M+ podcast episodes and 3.7M+ podcasts (e.g. \"artificial intelligence\", \"startup funding\", \"true crime\")", "minLength": 1 }, "type": { "type": "string", "enum": [ "episode", "podcast" ], "description": "Search type: \"episode\" (default) searches episode titles/descriptions, \"podcast\" searches podcast-level metadata", "default": "episode" }, "language": { "type": "string", "description": "ISO 639-1 language code (e.g. \"en\", \"es\", \"fr\"). Filters results by podcast language" }, "genre_ids": { "type": "string", "description": "Comma-separated genre IDs to filter (e.g. \"93,127\" for Business+Technology). See Listen Notes genre list" }, "sort_by_date": { "type": "boolean", "description": "Sort by date (true) or relevance (false, default)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 10, "description": "Max results (1-10, default 10)", "default": 10 }, "offset": { "type": "integer", "minimum": 0, "description": "Offset for pagination" } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "podcasts.listennotes.podcast", "description": "Get full details for a podcast by Listen Notes ID \u2014 title, publisher, description, episode count, language, country, website, genres, and latest publish date. Use IDs from listennotes.search or listennotes.best (Listen Notes)", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "Listen Notes podcast ID (e.g. \"4d3fe717742d4963a85562e9f84d8c79\"). Get IDs from listennotes.search or listennotes.best", "minLength": 1 } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "podcasts.listennotes.best", "description": "Get curated lists of the best podcasts by genre \u2014 Technology (127), Business (93), TV & Film (68), Sports (77), Leisure (82), and 60+ more genres. Paginated, returns podcast titles, publishers, episode counts, and descriptions (Listen Notes)", "inputSchema": { "type": "object", "properties": { "genre_id": { "type": "integer", "description": "Genre ID to filter (e.g. 93=Business, 127=Technology, 68=TV & Film, 82=Leisure, 77=Sports). Omit for overall best" }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)", "default": 1 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "music.audd.recognize", "description": "Identify a song from an audio file URL \u2014 like Shazam for AI agents. Analyzes audio fingerprint against 80M+ tracks and returns artist, title, album, release date, plus Spotify and Apple Music links. Accepts MP3, WAV, OGG, or any audio URL (AudD)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL of audio file to identify (MP3, WAV, OGG, etc.). The API analyzes the audio and matches it against 80M+ tracks. Example: \"https://example.com/song.mp3\"" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "music.audd.lyrics", "description": "Search for song lyrics by artist name, song title, or both. Returns full lyrics text, artist, title, and metadata. Query examples: \"imagine john lennon\", \"bohemian rhapsody\", \"taylor swift love story\" (AudD)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search query for lyrics \u2014 artist name, song title, or both (e.g. \"imagine john lennon\", \"bohemian rhapsody\", \"taylor swift love story\")", "minLength": 1 } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.materials.search", "description": "Search 150,000+ inorganic materials by chemical formula, elements, band gap, stability, or metallic character. Returns DFT-computed properties: band gap, formation energy, density, crystal system. Filter semiconductors (band_gap 1-3 eV), stable battery cathodes (elements Li,Fe,O + is_stable), or metals. DOE/Lawrence Berkeley Lab data, CC BY 4.0 (Materials Project)", "inputSchema": { "type": "object", "properties": { "formula": { "type": "string", "description": "Chemical formula to search (e.g. \"Si\", \"Fe2O3\", \"LiFePO4\"). Exact or reduced formula" }, "elements": { "type": "string", "description": "Comma-separated elements to filter (e.g. \"Li,Fe,O\" \u2014 returns materials containing these elements)" }, "band_gap_min": { "type": "number", "description": "Minimum band gap in eV (e.g. 1.0). Use with band_gap_max for range filter" }, "band_gap_max": { "type": "number", "description": "Maximum band gap in eV (e.g. 3.0). Use with band_gap_min for range filter" }, "is_stable": { "type": "boolean", "description": "Filter for thermodynamically stable materials only (energy_above_hull = 0)" }, "is_metal": { "type": "boolean", "description": "Filter for metals (true) or non-metals (false)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max results (1-50, default 10)", "default": 10 }, "skip": { "type": "integer", "minimum": 0, "description": "Offset for pagination" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.materials.details", "description": "Get full DFT-computed properties for a material by Materials Project ID (e.g. mp-149 for silicon). Returns: band gap, formation energy, thermodynamic stability, density, crystal structure, spacegroup, magnetism, bulk/shear modulus, Poisson ratio, Fermi energy, database cross-references. 150K+ materials (Materials Project)", "inputSchema": { "type": "object", "properties": { "material_id": { "type": "string", "description": "Materials Project ID (e.g. \"mp-149\" for silicon, \"mp-19017\" for LiFePO4). Get IDs from materials.search", "minLength": 1 } }, "required": [ "material_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "science.materials.elasticity", "description": "Get mechanical/elastic properties for a material: bulk modulus, shear modulus (Voigt-Reuss-Hill averages), universal anisotropy index, Poisson ratio, and full 6x6 elastic tensor (IEEE format). Essential for structural materials screening and mechanical simulations (Materials Project)", "inputSchema": { "type": "object", "properties": { "material_id": { "type": "string", "description": "Materials Project ID (e.g. \"mp-149\"). Returns bulk/shear modulus, Poisson ratio, elastic tensor", "minLength": 1 } }, "required": [ "material_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "logistics.tracking.register", "description": "Register a tracking number to begin monitoring shipment status. Auto-detects carrier from 3,200+ supported carriers worldwide (UPS, FedEx, DHL, USPS, China Post, Royal Mail, etc.). Must be called before tracking.status. Returns detected carrier and registration status. Consumes quota \u2014 200 free/month (17TRACK)", "inputSchema": { "type": "object", "properties": { "tracking_number": { "type": "string", "description": "Package tracking number (e.g. \"1Z999AA10123456784\" for UPS, \"9400111899560243888780\" for USPS). Carrier is auto-detected from 3,200+ supported carriers", "minLength": 3, "maxLength": 50 }, "tag": { "type": "string", "maxLength": 50, "description": "Optional label for this shipment (e.g. order ID, customer reference). Up to 50 characters" } }, "required": [ "tracking_number" ] }, "annotations": { "readOnlyHint": false, "destructiveHint": false, "idempotentHint": false, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "logistics.tracking.status", "description": "Get full tracking timeline for a registered package \u2014 latest status, all carrier scan events with timestamps and locations, delivery milestones, transit days, origin/destination countries. Supports 3,200+ carriers across 220 countries. Call tracking.register first if number is not yet registered (17TRACK)", "inputSchema": { "type": "object", "properties": { "tracking_number": { "type": "string", "description": "Tracking number previously registered with tracking.register. Returns full event timeline, carrier info, milestones, and delivery status", "minLength": 3, "maxLength": 50 } }, "required": [ "tracking_number" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "logistics.tracking.list", "description": "List all tracking numbers registered in your account with status summary \u2014 package status, latest event, transit days, registration time. Paginated. Filter by status: NotFound, InTransit, Delivered, Expired, Exception (17TRACK)", "inputSchema": { "type": "object", "properties": { "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)", "default": 1 }, "page_size": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Results per page (1-100, default 20)", "default": 20 }, "status": { "type": "string", "enum": [ "NotFound", "InTransit", "Delivered", "Expired", "Exception" ], "description": "Filter by package status" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "account.analytics.usage", "description": "Get your API usage summary \u2014 total calls, total cost, cache hit rate, average latency, and unique tools used. Filter by period: 1 day, 7 days, or 30 days. See how efficiently you are using the platform. Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "period": { "type": "string", "enum": [ "1d", "7d", "30d" ], "description": "Time period for usage stats: \"1d\" (24 hours), \"7d\" (7 days), or \"30d\" (30 days). Default: \"7d\"", "default": "7d" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "account.analytics.tools", "description": "Get per-tool usage breakdown \u2014 calls, cost, cache hits, average latency, last used. Sort by cost (highest spend), calls (most used), or latency (slowest). Identify your most-used and most-expensive tools. Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "sort": { "type": "string", "enum": [ "cost", "calls", "latency" ], "description": "Sort tools by: \"cost\" (highest spend), \"calls\" (most used), or \"latency\" (slowest). Default: \"calls\"", "default": "calls" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max number of tools to return (1-100). Default: 20", "default": 20 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "account.analytics.timeseries", "description": "Get time-series usage data \u2014 calls, cost, cache hits per hour or day over a period. Visualize usage patterns and trends. Choose granularity: hourly (for 1d period) or daily (for 7d/30d). Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "period": { "type": "string", "enum": [ "1d", "7d", "30d" ], "description": "Time period: \"1d\", \"7d\", or \"30d\". Default: \"7d\"", "default": "7d" }, "granularity": { "type": "string", "enum": [ "hour", "day" ], "description": "Time bucket granularity: \"hour\" or \"day\". Default: \"day\"", "default": "day" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "platform.quality.tool", "description": "Get quality metrics for any tool \u2014 uptime percentage, p50/p95 latency, error rate, total calls in last 24h. Check reliability before calling expensive tools. Updated every 10 minutes. Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "tool_id": { "type": "string", "description": "Tool ID to get quality metrics for (e.g. \"crypto.get_price\", \"weather.get_current\")", "minLength": 1 } }, "required": [ "tool_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "platform.quality.rankings", "description": "Get ranked list of tools by quality \u2014 sort by uptime (most reliable), latency (fastest), or error_rate (fewest errors). Filter by category (e.g. \"crypto\", \"weather\"). Discover the best tools for your use case. Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "sort": { "type": "string", "enum": [ "uptime", "latency", "error_rate" ], "description": "Sort by: \"uptime\" (highest availability), \"latency\" (fastest p50), or \"error_rate\" (lowest errors). Default: \"uptime\"", "default": "uptime" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max number of tools to return (1-100). Default: 20", "default": 20 }, "category": { "type": "string", "description": "Filter by tool category prefix (e.g. \"crypto\", \"weather\", \"finance\")" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "platform.batch.call", "description": "Execute up to 20 tool calls in a single request with parallel execution (max 10 concurrent). Each call runs the full pipeline independently with its own billing. Returns array of results with per-call status, data, cost, and duration. Save 5x round-trips vs sequential calls. Batch wrapper is free \u2014 you pay only for individual tool calls (APIbase)", "inputSchema": { "type": "object", "properties": { "calls": { "type": "array", "items": { "type": "object", "properties": { "tool_id": { "type": "string", "description": "Tool ID to call (e.g. \"crypto.get_price\")", "minLength": 1 }, "params": { "type": "object", "additionalProperties": {}, "description": "Parameters for the tool call" }, "idempotency_key": { "type": "string", "description": "Optional idempotency key for this specific call" } }, "required": [ "tool_id", "params" ] }, "description": "Array of tool calls to execute in parallel (max 20)", "minItems": 1, "maxItems": 20 }, "max_parallel": { "type": "integer", "minimum": 1, "maximum": 10, "description": "Max concurrent calls (1-10). Default: 10", "default": 10 } }, "required": [ "calls" ] }, "annotations": { "readOnlyHint": false, "destructiveHint": false, "idempotentHint": false, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.theirstack.search", "description": "Search 181M+ job postings worldwide \u2014 filter by keywords, country, remote, tech stack, recency. Returns title, company, location, salary range, post date. Job market intelligence for hiring analysis and talent sourcing (TheirStack)", "inputSchema": { "type": "object", "properties": { "keywords": { "type": "string", "description": "Comma-separated job title keywords (e.g. \"python developer, backend engineer\"). Matches job_title_or filter" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"US\", \"DE\", \"IN\")" }, "remote": { "type": "boolean", "description": "Filter remote-only jobs" }, "days": { "type": "integer", "minimum": 1, "maximum": 90, "description": "Max age in days (1-90). Only jobs posted within this window" }, "technologies": { "type": "string", "description": "Comma-separated tech stack filter (e.g. \"kubernetes, python, react\"). Matches technologies_or" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.theirstack.companies", "description": "Find companies by technology stack \u2014 filter by technologies (kubernetes, react, python...), country, minimum active jobs. Returns company name, URL, job count, tech stack. Identify employers using specific technologies (TheirStack)", "inputSchema": { "type": "object", "properties": { "technologies": { "type": "string", "description": "Comma-separated tech stack filter (e.g. \"kubernetes, docker, aws\"). Find companies using these technologies" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"US\", \"DE\", \"IN\")" }, "min_jobs": { "type": "integer", "minimum": 1, "description": "Minimum number of active job postings" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.jooble.search", "description": "Search aggregated job listings across 70+ countries \u2014 filter by keywords, location, radius, salary, company name. Returns title, company, location, salary, source, direct link. 9M+ active listings from thousands of job boards (Jooble)", "inputSchema": { "type": "object", "properties": { "keywords": { "type": "string", "description": "Job search keywords (e.g. \"python developer\", \"marketing manager\", \"nurse\")" }, "location": { "type": "string", "description": "Location (e.g. \"New York\", \"London\", \"Berlin\", \"Remote\")" }, "radius": { "type": "string", "enum": [ "0", "4", "8", "16", "26", "40", "80" ], "description": "Search radius in km from location: 0, 4, 8, 16, 26, 40, or 80" }, "salary": { "type": "number", "description": "Minimum salary filter (numeric)" }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)", "default": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results per page (1-20, default 10)", "default": 10 }, "company_search": { "type": "boolean", "description": "Set true to search by company name instead of job title" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.arbeitnow.browse", "description": "Browse European job listings \u2014 100 jobs per page sorted by newest. Returns title, company, location, remote flag, tags, job types, direct link. Updated hourly. EU-focused: Germany, Austria, Switzerland, Netherlands, and more. Open public API (Arbeitnow)", "inputSchema": { "type": "object", "properties": { "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1). Each page returns ~100 EU job listings sorted by newest first. No server-side search \u2014 use page to browse", "default": 1 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.reed.search", "description": "Search UK job listings \u2014 filter by keywords, location, distance, salary range (GBP), contract type (permanent/contract/temp), full/part time. Returns title, company, salary, applications count, direct link. UK largest job board (Reed.co.uk)", "inputSchema": { "type": "object", "properties": { "keywords": { "type": "string", "description": "Job search keywords (e.g. \"python developer\", \"data scientist\", \"nurse\")" }, "location": { "type": "string", "description": "UK location \u2014 city, town, or postcode (e.g. \"London\", \"Manchester\", \"SW1A 1AA\")" }, "distance": { "type": "integer", "minimum": 0, "description": "Search radius in miles from location (default 10)" }, "salary_min": { "type": "number", "description": "Minimum annual salary in GBP (e.g. 30000)" }, "salary_max": { "type": "number", "description": "Maximum annual salary in GBP (e.g. 80000)" }, "permanent": { "type": "boolean", "description": "Filter permanent positions only" }, "contract": { "type": "boolean", "description": "Filter contract positions only" }, "full_time": { "type": "boolean", "description": "Filter full-time positions only" }, "part_time": { "type": "boolean", "description": "Filter part-time positions only" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max results (1-100, default 25)", "default": 25 }, "skip": { "type": "integer", "minimum": 0, "description": "Number of results to skip for pagination (must be divisible by limit)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.reed.details", "description": "Get full details of a UK job listing by ID \u2014 title, company, full salary info (min/max GBP, annual/hourly/daily), contract type, full/part time, application count, full HTML description, external apply URL. Use job IDs from reed.search results (Reed.co.uk)", "inputSchema": { "type": "object", "properties": { "job_id": { "type": "integer", "description": "Reed job ID (from search results). Example: 56448344" } }, "required": [ "job_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "jobs.remotive.search", "description": "Search curated remote-only job listings \u2014 filter by keywords and category (software-dev, design, marketing, data, devops, etc.). Returns title, company, salary, job type, location requirements, tags. Global remote positions only (Remotive)", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Job search keywords (e.g. \"python\", \"react developer\", \"product manager\")" }, "category": { "type": "string", "description": "Job category slug: software-dev, design, customer-support, writing, marketing, sales, product, business, data, devops, finance, hr, qa, all-others" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max results (1-50, default 20)", "default": 20 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ecommerce.amazon.search", "description": "Search Amazon products by keyword \u2014 filter by price range, sort by relevance/price/rating/reviews/newest. Returns title, ASIN, price, rating, Prime flag, image. 12 marketplaces: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (Canopy API)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search keywords (e.g. \"wireless headphones\", \"raspberry pi 5\")" }, "domain": { "type": "string", "description": "Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)", "default": "US" }, "page": { "type": "integer", "minimum": 1, "description": "Page number for pagination" }, "sort": { "type": "string", "enum": [ "relevance", "price_asc", "price_desc", "rating", "reviews", "newest" ], "description": "Sort order: relevance, price_asc, price_desc, rating, reviews, newest" }, "price_min": { "type": "number", "description": "Minimum price filter (in marketplace currency)" }, "price_max": { "type": "number", "description": "Maximum price filter (in marketplace currency)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ecommerce.amazon.product", "description": "Get full Amazon product details by ASIN \u2014 title, brand, price, rating, stock status, feature bullets, categories, seller name. Use ASINs from canopy.search. 12 Amazon marketplaces supported (Canopy API)", "inputSchema": { "type": "object", "properties": { "asin": { "type": "string", "description": "Amazon ASIN product ID (e.g. \"B0CRSNCJ6Y\"). Get ASINs from canopy.search" }, "domain": { "type": "string", "description": "Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)", "default": "US" } }, "required": [ "asin" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ecommerce.amazon.offers", "description": "Get all third-party seller offers for an Amazon product \u2014 price, condition (new/used), seller name & rating, Buy Box winner flag, Fulfilled by Amazon, delivery estimate. Price comparison across sellers (Canopy API)", "inputSchema": { "type": "object", "properties": { "asin": { "type": "string", "description": "Amazon ASIN product ID. Returns all third-party offers with Buy Box winner, seller ratings, delivery info" }, "domain": { "type": "string", "description": "Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)", "default": "US" } }, "required": [ "asin" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ecommerce.amazon.deals", "description": "Browse current Amazon deals \u2014 original price vs deal price, product title, ASIN, deal link. Paginated, 500+ active deals. 12 Amazon marketplaces (Canopy API)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)", "default": "US" }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "scraping.spider.scrape", "description": "Scrape any web page and get clean content \u2014 markdown (default), plain text, or raw HTML. Handles JavaScript rendering, anti-bot bypass, proxy rotation. Returns LLM-ready output. Cheapest web scraper with PAYG pricing (Spider.cloud)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to scrape (e.g. \"https://example.com/page\")" }, "format": { "type": "string", "enum": [ "markdown", "text", "raw", "commonmark" ], "description": "Output format: markdown (default, best for LLMs), text (plain), raw (HTML), commonmark", "default": "markdown" }, "readability": { "type": "boolean", "description": "Enable readability mode \u2014 pre-processes page for LLM consumption" }, "wait_for": { "type": "integer", "minimum": 0, "maximum": 30000, "description": "Wait N ms for JS to render before scraping (0-30000)" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "scraping.spider.search", "description": "Web search that returns page titles, descriptions, and URLs. Combine with spider.scrape to get full content. Results ranked by relevance (Spider.cloud)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Web search query (e.g. \"best MCP servers 2026\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results (1-20, default 5)", "default": 5 } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.imgflip.memes", "description": "Get top 100 popular meme templates \u2014 Drake Hotline Bling, Two Buttons, Distracted Boyfriend, and more. Returns template ID, name, image URL, box count. Use IDs with imgflip.caption to generate memes (Imgflip)", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Optional: filter memes by name (client-side). Returns top 100 popular meme templates." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.imgflip.caption", "description": "Generate a captioned meme image from a template ID + top/bottom text. Returns direct image URL. Use imgflip.memes to find template IDs. 100K+ templates available (Imgflip)", "inputSchema": { "type": "object", "properties": { "template_id": { "type": "string", "description": "Meme template ID from imgflip.memes (e.g. \"181913649\" for Drake Hotline Bling, \"87743020\" for Two Buttons)" }, "top_text": { "type": "string", "description": "Top text on the meme" }, "bottom_text": { "type": "string", "description": "Bottom text on the meme" } }, "required": [ "template_id" ] }, "annotations": { "readOnlyHint": false, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "recipes.cocktail.search", "description": "Search 10,000+ cocktail recipes by name or filter by ingredient. Returns name, category, glass type, instructions, ingredients with measures, image. Search \"margarita\" or filter by \"Vodka\" (TheCocktailDB)", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Cocktail name to search (e.g. \"margarita\", \"mojito\", \"old fashioned\")" }, "ingredient": { "type": "string", "description": "Filter by ingredient (e.g. \"Vodka\", \"Rum\", \"Gin\"). Returns cocktails containing this ingredient. Use name OR ingredient, not both." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "recipes.cocktail.random", "description": "Get a random cocktail recipe with full details \u2014 name, category, glass, instructions, ingredients, measures, image. Great for discovery and recommendations (TheCocktailDB)", "inputSchema": { "type": "object", "properties": { "count": { "type": "integer", "minimum": 1, "maximum": 1, "description": "Always returns 1 random cocktail with full recipe", "default": 1 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "developer.github.search", "description": "Search GitHub repositories by keyword, language, stars, topics. Returns name, description, stars, forks, language, license, owner. Sort by stars/forks/updated. 86K+ MCP repos, 372M+ total repos (GitHub API)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query (e.g. \"mcp server\", \"react framework\", \"language:python stars:>1000\")" }, "sort": { "type": "string", "enum": [ "stars", "forks", "updated", "help-wanted-issues" ], "description": "Sort by: stars (default), forks, updated, help-wanted-issues", "default": "stars" }, "limit": { "type": "integer", "minimum": 1, "maximum": 30, "description": "Max results (1-30, default 10)", "default": 10 } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "developer.github.user", "description": "Get a GitHub user profile \u2014 name, bio, public repos count, followers, company, location, join date. Works for users and organizations (GitHub API)", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "GitHub username (e.g. \"torvalds\", \"whiteknightonhorse\")" } }, "required": [ "username" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "developer.github.repo", "description": "Get full details of a GitHub repository \u2014 description, stars, forks, language, topics, license, last update. Public repos only (GitHub API)", "inputSchema": { "type": "object", "properties": { "owner": { "type": "string", "description": "Repository owner (e.g. \"facebook\", \"microsoft\")" }, "repo": { "type": "string", "description": "Repository name (e.g. \"react\", \"vscode\")" } }, "required": [ "owner", "repo" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "knowledge.wikidata.search", "description": "Search 100M+ structured entities in Wikidata \u2014 people, companies, places, concepts. Returns entity ID, label, description. Use IDs with wikidata.entity for full details. CC-0 public domain (Wikidata)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query (e.g. \"Tesla\", \"Barack Obama\", \"JavaScript\", \"Mount Everest\")" }, "language": { "type": "string", "description": "Language code for labels (e.g. \"en\", \"de\", \"fr\", \"ja\"). Default: en", "default": "en" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results (1-20, default 10)", "default": 10 } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "knowledge.wikidata.entity", "description": "Get structured data for a Wikidata entity by ID (e.g. Q42 = Douglas Adams). Returns labels, descriptions, aliases, and up to 20 property statements. 300+ languages supported. CC-0 (Wikidata)", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "Wikidata entity ID (e.g. \"Q42\" for Douglas Adams, \"Q478214\" for Tesla Inc). Get IDs from wikidata.search" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "language.dictionary.define", "description": "Get word definition \u2014 phonetic pronunciation, part of speech, definitions with examples, synonyms, antonyms, audio URL. Supports 12 languages: en, es, fr, de, it, pt, ru, ar, hi, ja, ko, zh (Free Dictionary API)", "inputSchema": { "type": "object", "properties": { "word": { "type": "string", "description": "Word to define (e.g. \"algorithm\", \"serendipity\", \"ubuntu\")" }, "language": { "type": "string", "description": "Language code: en, es, fr, de, it, pt, ru, ar, hi, ja, ko, zh (default: en)", "default": "en" } }, "required": [ "word" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "language.dictionary.words", "description": "Find words by meaning, sound, rhyme, or spelling pattern. \"happy\" \u2192 pleased, blissful. \"algorithm\" rhymes \u2192 rhythm, logarithm. Great for writing, creative tasks, word games (Datamuse)", "inputSchema": { "type": "object", "properties": { "meaning": { "type": "string", "description": "Find words with this meaning (e.g. \"happy\" \u2192 pleased, blissful, content)" }, "sounds_like": { "type": "string", "description": "Find words that sound like this (e.g. \"elefant\" \u2192 elephant)" }, "rhymes_with": { "type": "string", "description": "Find words that rhyme with this (e.g. \"algorithm\" \u2192 rhythm, logarithm)" }, "starts_with": { "type": "string", "description": "Find words starting with these letters (e.g. \"algor\" \u2192 algorithm, algorithmic)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "noaa.weather.forecast", "title": "NOAA 7-Day Forecast", "description": "Get 7-day weather forecast for a US location by latitude/longitude. Returns day and night periods with temperature (\u00b0F), precipitation chance, wind speed/direction, and detailed forecast text. Powered by NOAA National Weather Service (api.weather.gov). US contiguous only.", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "Latitude in decimal degrees (US contiguous only: 24\u201350)", "minimum": 24, "maximum": 50 }, "longitude": { "type": "number", "description": "Longitude in decimal degrees (US contiguous only: \u2212125 to \u221266)", "minimum": -125, "maximum": -66 } }, "required": [ "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "noaa.weather.hourly", "title": "NOAA Hourly Forecast", "description": "Get hourly weather forecast (next 48 hours) for a US location by latitude/longitude. Returns temperature (\u00b0F), precipitation chance, wind speed/direction, and short conditions per hour. Powered by NOAA National Weather Service. US contiguous only.", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "Latitude in decimal degrees (US contiguous only: 24\u201350)", "minimum": 24, "maximum": 50 }, "longitude": { "type": "number", "description": "Longitude in decimal degrees (US contiguous only: \u2212125 to \u221266)", "minimum": -125, "maximum": -66 } }, "required": [ "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "noaa.weather.observation", "title": "NOAA Latest Observation", "description": "Get latest weather observation from the nearest ASOS/AWOS station to a US location. Returns current temperature (\u00b0C/\u00b0F), humidity, wind, pressure, visibility, dewpoint, heat index, wind chill. Powered by NOAA National Weather Service. US contiguous only.", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "Latitude in decimal degrees (US contiguous only: 24\u201350)", "minimum": 24, "maximum": 50 }, "longitude": { "type": "number", "description": "Longitude in decimal degrees (US contiguous only: \u2212125 to \u221266)", "minimum": -125, "maximum": -66 } }, "required": [ "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "whoisjson.ssl.check", "title": "SSL Certificate Check", "description": "Validate SSL/TLS certificate for any domain. Returns issuer (org, CN), validity dates, subject CN, wildcard status, key size, and Subject Alternative Names (SAN) list. Useful for security audits, monitoring cert expiration, and verifying HTTPS configuration (WhoisJSON)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to check SSL certificate (e.g. google.com, apibase.pro)", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "whoisjson.dns.subdomains", "title": "Subdomain Discovery", "description": "Discover subdomains for any domain via DNS brute-force enumeration. Returns subdomain names, DNS record types (A/CNAME/MX), resolved IPs, and active/inactive status. Useful for security reconnaissance, asset inventory, and infrastructure mapping (WhoisJSON)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to discover subdomains (e.g. github.com, example.com)", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "npm.packages.downloads", "title": "npm Download Stats", "description": "Get download count for any npm package over a time period: last-day, last-week, last-month, last-year. Useful for measuring package popularity, adoption trends, and comparing alternatives (e.g. express: 92M/week).", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "npm package name (e.g. express, lodash, typescript)", "minLength": 1 }, "period": { "type": "string", "enum": [ "last-day", "last-week", "last-month", "last-year" ], "description": "Time period for download stats (default: last-week)" } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "npm.packages.info", "title": "npm Package Info", "description": "Get metadata for any npm package: version, description, license, dependencies, maintainers, repository URL, keywords, engines. 2.1M+ packages. Supports scoped packages (@scope/name). Returns latest version by default or a specific version.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "npm package name (e.g. express, react, @anthropic-ai/sdk)", "minLength": 1 }, "version": { "type": "string", "description": "Specific version to fetch (e.g. 5.2.1). Defaults to latest" } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "npm.packages.search", "title": "npm Package Search", "description": "Search 2.1M+ npm packages by keyword. Returns ranked results with quality, popularity, and maintenance scores, download counts, dependents, license, publisher. Find libraries for any task (e.g. \"mcp server\", \"react hooks\", \"typescript orm\").", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query (e.g. \"mcp server\", \"react hooks\", \"typescript orm\")", "minLength": 1 }, "size": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results to return (1-20, default 10)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "npm.packages.versions", "title": "npm Package Versions", "description": "List all published versions of an npm package with dist-tags (latest, next, beta), deprecation status, and total version count. Returns the 50 most recent versions. Useful for dependency auditing and upgrade planning.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "npm package name to list all versions (e.g. express, react)", "minLength": 1 } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "osv.security.batch", "title": "Batch Vulnerability Scan", "description": "Scan up to 100 packages at once for known vulnerabilities. Submit package+version+ecosystem triples (e.g. full requirements.txt or package.json dependencies) and get vulnerability matches for all in a single call. Ideal for full dependency tree security audits.", "inputSchema": { "type": "object", "properties": { "queries": { "type": "array", "items": { "type": "object", "properties": { "package": { "type": "string", "description": "Package name", "minLength": 1 }, "version": { "type": "string", "description": "Package version", "minLength": 1 }, "ecosystem": { "type": "string", "enum": [ "npm", "PyPI", "Go", "Maven", "crates.io", "NuGet", "Packagist", "RubyGems", "Pub", "Hex", "SwiftURL", "Linux", "Android", "OSS-Fuzz", "GIT" ], "description": "Package ecosystem (npm, PyPI, Go, Maven, crates.io, NuGet, Packagist, RubyGems, etc.)" } }, "required": [ "package", "version", "ecosystem" ] }, "description": "List of package+version+ecosystem to check (max 100)", "minItems": 1, "maxItems": 100 } }, "required": [ "queries" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "osv.security.get", "title": "Get Vulnerability Details", "description": "Retrieve full details for a vulnerability by OSV ID (GHSA-xxxx), CVE ID (CVE-2021-xxxxx), or ecosystem ID (PYSEC/RUSTSEC/GO). Returns summary, CVSS severity, affected packages with fix versions, and reference links.", "inputSchema": { "type": "object", "properties": { "vuln_id": { "type": "string", "description": "Vulnerability ID \u2014 OSV (e.g. GHSA-35jh-r3h4-6jhm), CVE (e.g. CVE-2021-23337), or PYSEC/GO/RUSTSEC ID", "minLength": 1 } }, "required": [ "vuln_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "osv.security.query", "title": "Query Package Vulnerabilities", "description": "Check known vulnerabilities for a specific package version in any ecosystem (npm, PyPI, Go, Maven, Rust, NuGet, 14+ more). Returns CVE/GHSA IDs, severity scores, and affected package counts. Powered by Google OSV.dev \u2014 aggregates GitHub Security Advisories, NVD, and ecosystem-native databases.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "Package name (e.g. lodash, requests, gin-gonic/gin)", "minLength": 1 }, "version": { "type": "string", "description": "Package version to check (e.g. 4.17.20, 2.25.0)", "minLength": 1 }, "ecosystem": { "type": "string", "enum": [ "npm", "PyPI", "Go", "Maven", "crates.io", "NuGet", "Packagist", "RubyGems", "Pub", "Hex", "SwiftURL", "Linux", "Android", "OSS-Fuzz", "GIT" ], "description": "Package ecosystem (npm, PyPI, Go, Maven, crates.io, NuGet, Packagist, RubyGems, etc.)" } }, "required": [ "package", "version", "ecosystem" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "census.data.demographics", "title": "US Demographics Data", "description": "Get demographic composition for any US geography \u2014 median age, race (white/Black/Asian), Hispanic/Latino population, and bachelor's degree attainment. Source: ACS 5-year estimates (US Census Bureau). Useful for market research, policy analysis, and neighborhood profiling.", "inputSchema": { "type": "object", "properties": { "state_fips": { "type": "string", "description": "US state FIPS code (e.g. 06 for California, 36 for New York, * for all states)", "minLength": 1, "maxLength": 2 }, "county_fips": { "type": "string", "description": "County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data." }, "year": { "type": "integer", "minimum": 2010, "maximum": 2023, "description": "Survey year (default 2022). ACS 5-year estimates available 2010-2022." } }, "required": [ "state_fips" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "census.data.economic", "title": "US Economic Data", "description": "Get economic indicators for any US geography \u2014 median household income, population in poverty, and unemployed count. Source: ACS 5-year estimates (US Census Bureau). Key data for market sizing, real estate analysis, and business location intelligence.", "inputSchema": { "type": "object", "properties": { "state_fips": { "type": "string", "description": "US state FIPS code (e.g. 06 for California, 36 for New York, * for all states)", "minLength": 1, "maxLength": 2 }, "county_fips": { "type": "string", "description": "County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data." }, "year": { "type": "integer", "minimum": 2010, "maximum": 2023, "description": "Survey year (default 2022). ACS 5-year estimates available 2010-2022." } }, "required": [ "state_fips" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "census.data.housing", "title": "US Housing Data", "description": "Get housing statistics for any US geography \u2014 total units, median home value, median rent, owner-occupied vs renter-occupied counts. Source: ACS 5-year estimates (US Census Bureau). Essential for real estate agents, property valuations, and housing market analysis.", "inputSchema": { "type": "object", "properties": { "state_fips": { "type": "string", "description": "US state FIPS code (e.g. 06 for California, 36 for New York, * for all states)", "minLength": 1, "maxLength": 2 }, "county_fips": { "type": "string", "description": "County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data." }, "year": { "type": "integer", "minimum": 2010, "maximum": 2023, "description": "Survey year (default 2022). ACS 5-year estimates available 2010-2022." } }, "required": [ "state_fips" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "census.data.population", "title": "US Population Data", "description": "Get population counts for any US geography by FIPS code \u2014 total, male, female. Covers all 50 states, 3,000+ counties, and sub-county areas. Source: American Community Survey 5-year estimates (US Census Bureau). Public domain, updated annually.", "inputSchema": { "type": "object", "properties": { "state_fips": { "type": "string", "description": "US state FIPS code (e.g. 06 for California, 36 for New York, * for all states)", "minLength": 1, "maxLength": 2 }, "county_fips": { "type": "string", "description": "County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data." }, "year": { "type": "integer", "minimum": 2010, "maximum": 2023, "description": "Survey year (default 2022). ACS 5-year estimates available 2010-2022." } }, "required": [ "state_fips" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "spending.federal.agency", "title": "Federal Agency Spending", "description": "Search federal awards by agency name (e.g. \"Defense\", \"NASA\", \"Health and Human Services\"). Returns top awards by amount for a fiscal year. Source: USAspending.gov \u2014 covers all federal agencies.", "inputSchema": { "type": "object", "properties": { "agency_name": { "type": "string", "description": "Federal agency name or keyword (e.g. \"Defense\", \"NASA\", \"Health and Human Services\")", "minLength": 1 }, "fiscal_year": { "type": "integer", "minimum": 2000, "maximum": 2026, "description": "Fiscal year (e.g. 2025). Default: current year." }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of top awards to return (1-25, default 10)" } }, "required": [ "agency_name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "spending.federal.awards", "title": "Federal Award Search", "description": "Search 60M+ US federal contract and grant awards by keyword, recipient, or NAICS code. Returns award amount, recipient, agency, dates, and description. Sorted by amount descending. Source: USAspending.gov (DATA Act mandate, US Gov open data).", "inputSchema": { "type": "object", "properties": { "keyword": { "type": "string", "description": "Search keyword for federal awards (e.g. \"artificial intelligence\", \"cybersecurity\", company name)", "minLength": 1 }, "fiscal_year": { "type": "integer", "minimum": 2000, "maximum": 2026, "description": "Fiscal year to filter (e.g. 2025). Default: current year." }, "award_type": { "type": "string", "enum": [ "contracts", "grants", "all" ], "description": "Filter by award type: contracts, grants, or all (default: all)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of results to return (1-25, default 10)" } }, "required": [ "keyword" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "spending.federal.geography", "title": "Federal Spending by State", "description": "Get total US federal spending by state for contracts, grants, or all awards in a fiscal year. Returns all 50+ states sorted by spending amount. Useful for regional economic analysis and policy research. Source: USAspending.gov.", "inputSchema": { "type": "object", "properties": { "fiscal_year": { "type": "integer", "minimum": 2017, "maximum": 2026, "description": "Fiscal year (e.g. 2025). Default: current year." }, "award_type": { "type": "string", "enum": [ "contracts", "grants", "all" ], "description": "Filter by award type: contracts, grants, or all (default: all)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "sam.gov.entity_detail", "title": "SAM.gov Entity Detail", "description": "Get full SAM.gov registration details for a federal contractor by UEI (Unique Entity Identifier). Returns legal name, CAGE code, addresses, NAICS/PSC codes, business certifications, entity structure, organization type, and registration dates. Source: SAM.gov (GSA).", "inputSchema": { "type": "object", "properties": { "uei": { "type": "string", "description": "Unique Entity Identifier (UEI) \u2014 12-character SAM.gov ID (e.g. KM99JJBNQ9M5 for Lockheed Martin)", "minLength": 1 } }, "required": [ "uei" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "sam.gov.entity_search", "title": "SAM.gov Entity Search", "description": "Search 700K+ registered US federal contractors and grantees by company name, state, or NAICS code. Returns UEI (Unique Entity Identifier), CAGE code, registration status, business types (Small Business, 8(a), HUBZone, WOSB, Veteran-Owned), and NAICS codes. Source: SAM.gov (GSA).", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Company or organization name to search (e.g. \"Lockheed\", \"Google\", \"Deloitte\"). Supports partial match.", "minLength": 1 }, "state": { "type": "string", "maxLength": 2, "description": "US state code to filter (e.g. VA, CA, TX)" }, "naics_code": { "type": "string", "description": "NAICS industry code to filter (e.g. 541512 for Computer Systems Design)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of results (1-25, default 10)" } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "fema.disaster.assistance", "title": "FEMA Housing Assistance", "description": "Query federal disaster housing assistance data by state and disaster number. Returns registration counts, average damage, total inspected, approved amounts by county. Useful for disaster recovery analysis and aid distribution research. Source: OpenFEMA.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "US state code (e.g. TX, FL, CA)", "minLength": 2, "maxLength": 2 }, "disaster_number": { "type": "integer", "description": "FEMA disaster number to filter (e.g. 4673)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "state" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "fema.disaster.declarations", "title": "FEMA Disaster Declarations", "description": "Search US federal disaster declarations from 1953 to present. Filter by state, incident type (Fire, Flood, Hurricane, Tornado, Earthquake), and year. Returns disaster number, title, dates, designated programs (IA, PA, HM). Source: OpenFEMA (US Gov open data).", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "US state code (e.g. CA, TX, FL). Omit for all states." }, "incident_type": { "type": "string", "enum": [ "Fire", "Flood", "Hurricane", "Tornado", "Earthquake", "Severe Storm(s)", "Snow", "Drought", "Typhoon", "Biological", "Other" ], "description": "Disaster type to filter (e.g. Fire, Flood, Hurricane)" }, "year": { "type": "integer", "minimum": 1953, "maximum": 2026, "description": "Filter by declaration year (1953-2026)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "fema.disaster.flood_claims", "title": "NFIP Flood Insurance Claims", "description": "Retrieve National Flood Insurance Program (NFIP) claims by state and year. Returns flood zone, building/contents payments, insurance coverage amounts, cause of damage. Essential for flood risk assessment and insurance analysis. Source: OpenFEMA.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "US state code (e.g. FL, TX, LA)", "minLength": 2, "maxLength": 2 }, "year": { "type": "integer", "minimum": 1970, "maximum": 2026, "description": "Year of loss to filter (e.g. 2024)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "state" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "pypi.packages.info", "title": "PyPI Package Info", "description": "Get metadata for any Python package from PyPI: version, summary, license, author, dependencies, classifiers, Python version requirements. 550K+ packages. Supports specific version lookup. Complements npm (UC-344) for polyglot dependency intelligence.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "Python package name (e.g. requests, flask, numpy, anthropic)", "minLength": 1 }, "version": { "type": "string", "description": "Specific version (e.g. 2.31.0). Defaults to latest release." } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "pypi.packages.releases", "title": "PyPI Package Versions", "description": "List all published versions of a Python package with upload dates, yanked status, and distribution file types (sdist/wheel). Returns the 50 most recent versions. Useful for dependency auditing, version pinning, and upgrade planning.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "Python package name to list all versions (e.g. django, pandas, scipy)", "minLength": 1 } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gbif.biodiversity.occurrence_count", "title": "GBIF Occurrence Count", "description": "Get total occurrence count for a species, optionally filtered by country. Useful for range size estimation, data density assessment, and conservation status analysis. Source: GBIF.", "inputSchema": { "type": "object", "properties": { "taxon_key": { "type": "integer", "description": "GBIF taxon key to count occurrences for" }, "country": { "type": "string", "minLength": 2, "maxLength": 2, "description": "ISO country code to filter count (e.g. US, BR)" } }, "required": [ "taxon_key" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gbif.biodiversity.occurrences", "title": "GBIF Species Occurrences", "description": "Search 2.5B+ species occurrence records by taxon, country, and year. Returns observation coordinates, date, collector institution, basis of record (specimen/observation). Filter by ISO country code. Source: GBIF (2000+ institutions, 100+ countries).", "inputSchema": { "type": "object", "properties": { "taxon_key": { "type": "integer", "description": "GBIF taxon key for the species to search occurrences" }, "country": { "type": "string", "minLength": 2, "maxLength": 2, "description": "ISO 3166-1 alpha-2 country code (e.g. US, GB, BR, AU)" }, "year": { "type": "integer", "minimum": 1700, "maximum": 2026, "description": "Filter by observation year (e.g. 2024)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "taxon_key" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gbif.biodiversity.species_details", "title": "GBIF Species Details", "description": "Get full taxonomic profile for a species by GBIF taxon key. Returns classification hierarchy, vernacular (common) names, synonyms, number of descendants, and accepted name. Source: GBIF backbone taxonomy.", "inputSchema": { "type": "object", "properties": { "taxon_key": { "type": "integer", "description": "GBIF taxon key (numeric ID from species search results)" } }, "required": [ "taxon_key" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gbif.biodiversity.species_search", "title": "GBIF Species Search", "description": "Search 9M+ species in the GBIF backbone taxonomy by common or scientific name. Returns taxon key, scientific name, kingdom/phylum/class/order/family/genus, and taxonomic status. Filter by rank (SPECIES, GENUS, FAMILY). Source: Global Biodiversity Information Facility (CC0).", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Species name to search \u2014 common name (e.g. \"polar bear\") or scientific name (e.g. \"Ursus maritimus\")", "minLength": 1 }, "rank": { "type": "string", "enum": [ "KINGDOM", "PHYLUM", "CLASS", "ORDER", "FAMILY", "GENUS", "SPECIES" ], "description": "Taxonomic rank filter (default: SPECIES). Use SPECIES to avoid virus/subspecies matches." }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results (1-20, default 5)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "congress.legislation.bill_details", "title": "US Bill Details", "description": "Get full details for a specific US bill by Congress number, type (hr/s), and bill number. Returns title, all sponsors, co-sponsor count, action history, committee referrals, policy subjects. Source: Congress.gov.", "inputSchema": { "type": "object", "properties": { "congress": { "type": "integer", "description": "Congress number (e.g. 119 for 2025-2026, 118 for 2023-2024)", "minimum": 93, "maximum": 119 }, "type": { "type": "string", "enum": [ "hr", "s", "hjres", "sjres", "hconres", "sconres", "hres", "sres" ], "description": "Bill type: hr (House bill), s (Senate bill), hjres, sjres, etc." }, "number": { "type": "integer", "description": "Bill number (e.g. 1 for HR 1)", "minimum": 1 } }, "required": [ "congress", "type", "number" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "congress.legislation.bills", "title": "US Congressional Bills", "description": "Search US federal bills and resolutions from 1973 to present. Filter by Congress number (93-119), bill type (hr/s/hjres/sjres). Returns title, sponsor, party, latest action, policy area. Source: Congress.gov (Library of Congress).", "inputSchema": { "type": "object", "properties": { "congress": { "type": "integer", "minimum": 93, "maximum": 119, "description": "Congress number (93=1973 to 119=2025-2026). Default: current (119)." }, "type": { "type": "string", "enum": [ "hr", "s", "hjres", "sjres", "hconres", "sconres", "hres", "sres" ], "description": "Bill type: hr (House), s (Senate), hjres, sjres, hconres, sconres, hres, sres" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of results (1-25, default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "congress.legislation.members", "title": "US Congressional Members", "description": "Search current and historical members of the US Congress. Filter by state, chamber (House/Senate), and Congress number. Returns name, party, state, district, bioguide ID. Source: Congress.gov.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "US state code (e.g. CA, TX, NY)" }, "chamber": { "type": "string", "enum": [ "house", "senate" ], "description": "Chamber: house or senate" }, "congress": { "type": "integer", "minimum": 93, "maximum": 119, "description": "Congress number. Default: current (119)." }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of results (1-25, default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "depsdev.insights.advisories", "title": "Security Advisories (deps.dev)", "description": "List security advisories (from OSV) affecting a specific package version. Cross-ecosystem: npm, PyPI, Go, Maven, Cargo, NuGet. Returns advisory IDs with links to OSV.dev for full details. Complements osv.query for version-specific lookups.", "inputSchema": { "type": "object", "properties": { "system": { "type": "string", "enum": [ "npm", "pypi", "go", "maven", "cargo", "nuget" ], "description": "Package ecosystem: npm, pypi, go, maven, cargo, or nuget" }, "package": { "type": "string", "description": "Package name to check for security advisories", "minLength": 1 }, "version": { "type": "string", "description": "Package version to check (e.g. 4.17.20)", "minLength": 1 } }, "required": [ "system", "package", "version" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "depsdev.insights.dependencies", "title": "Dependency Tree (deps.dev)", "description": "Resolve the full transitive dependency tree for a package version. Returns all direct and indirect dependencies with versions and relation type. Reveals hidden supply chain depth (e.g. express@5.2.1 has 67 transitive deps). Google deps.dev.", "inputSchema": { "type": "object", "properties": { "system": { "type": "string", "enum": [ "npm", "pypi", "go", "maven", "cargo", "nuget" ], "description": "Package ecosystem: npm, pypi, go, maven, cargo, or nuget" }, "package": { "type": "string", "description": "Package name (e.g. lodash, flask, github.com/gin-gonic/gin)", "minLength": 1 }, "version": { "type": "string", "description": "Package version to resolve dependencies for (e.g. 4.17.21, 3.0.0)", "minLength": 1 } }, "required": [ "system", "package", "version" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "depsdev.insights.package", "title": "Package Info (deps.dev)", "description": "Get package metadata from Google deps.dev \u2014 all versions, default version, ecosystem. Covers npm, PyPI, Go, Maven, Cargo, NuGet (50M+ package versions). Complements npm/PyPI registries with cross-ecosystem unified view.", "inputSchema": { "type": "object", "properties": { "system": { "type": "string", "enum": [ "npm", "pypi", "go", "maven", "cargo", "nuget" ], "description": "Package ecosystem: npm, pypi, go, maven, cargo, or nuget" }, "package": { "type": "string", "description": "Package name (e.g. express, requests, gin-gonic/gin, log4j-core)", "minLength": 1 } }, "required": [ "system", "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "epa.environment.toxic_releases", "title": "EPA Toxic Release Inventory", "description": "Search EPA Toxic Release Inventory (TRI) facilities by US state or ZIP code. Returns facility name, address, county, industry sector, and closed status. 600K+ regulated facilities. Source: EPA Envirofacts (US Gov open data).", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "US state code (e.g. CA, TX, NY, FL)", "minLength": 2, "maxLength": 2 }, "zip_code": { "type": "string", "description": "ZIP code to filter (e.g. 90001). Overrides state filter if provided." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "state" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "epa.environment.water_systems", "title": "EPA Public Water Systems", "description": "Search public water systems by US state. Returns system name, PWSID, activity status, primacy agency, EPA region, population served, and service connections. Source: EPA Safe Drinking Water Act data.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "US state code (e.g. FL, CA, TX)", "minLength": 2, "maxLength": 2 }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "state" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ncei.climate.daily_data", "title": "NCEI Daily Climate Data", "description": "Retrieve historical daily weather observations from NOAA NCEI \u2014 max/min temperature, precipitation, snowfall, wind speed. 260+ years of records from global stations. Values in tenths of \u00b0C (temp) and tenths of mm (precip). Source: GHCND dataset.", "inputSchema": { "type": "object", "properties": { "station_id": { "type": "string", "description": "NCEI station ID (e.g. GHCND:USW00094728 for Central Park, NY). Get from ncei.stations tool.", "minLength": 1 }, "start_date": { "type": "string", "description": "Start date in YYYY-MM-DD format (e.g. 2025-01-01)" }, "end_date": { "type": "string", "description": "End date in YYYY-MM-DD format (e.g. 2025-01-31). Max 1 year range." }, "datatypes": { "type": "string", "description": "Comma-separated data types: TMAX (max temp), TMIN (min temp), PRCP (precipitation), SNOW, AWND (avg wind). Default: all." } }, "required": [ "station_id", "start_date", "end_date" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "ncei.climate.stations", "title": "NCEI Weather Stations", "description": "Search 100K+ global weather stations from NOAA NCEI by location (state FIPS, ZIP, country). Returns station ID, name, coordinates, elevation, and data coverage dates (some from 1700s). Use station IDs with ncei.daily_data for historical climate records.", "inputSchema": { "type": "object", "properties": { "location_id": { "type": "string", "description": "Location ID: FIPS:06 (California), FIPS:36 (New York), ZIP:10001, CITY:US360019, or CNTRY:US", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of stations to return (1-25, default 10)" } }, "required": [ "location_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "climate.indicators.arctic_ice", "title": "Arctic Sea Ice Extent", "description": "Arctic sea ice extent from NSIDC \u2014 monthly measurements in million km\u00b2 since 1979. Tracks long-term decline in Arctic ice coverage. Returns last 10 years by default. Source: National Snow and Ice Data Center.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "climate.indicators.co2", "title": "Atmospheric CO2 (Keeling Curve)", "description": "Atmospheric CO2 concentration from NOAA Mauna Loa Observatory \u2014 the Keeling Curve. Monthly readings in ppm (parts per million) since 1958. Returns last 10 years by default. Source: NOAA ESRL.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "climate.indicators.methane", "title": "Atmospheric Methane", "description": "Atmospheric methane concentration from NOAA ESRL \u2014 monthly readings in ppb (parts per billion) since 1983. Methane is the second most important greenhouse gas after CO2. Returns last 10 years by default.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "climate.indicators.nitrous_oxide", "title": "Atmospheric Nitrous Oxide", "description": "Atmospheric nitrous oxide concentration from NOAA ESRL \u2014 monthly readings in ppb since 2001. N2O is a potent greenhouse gas with 273x the warming potential of CO2. Returns last 10 years by default.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "climate.indicators.temperature", "title": "Global Temperature Anomaly", "description": "Global surface temperature anomaly from NASA GISS \u2014 monthly readings since 1880. Values in \u00b0C vs 1951-1980 baseline. Returns last 10 years by default (adjustable 1-50). Source: NASA Goddard Institute for Space Studies.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "chart.visualization.create", "title": "Create Chart Image", "description": "\u26a1 ACTION: Generate a chart image (PNG) from data \u2014 bar, line, pie, doughnut, radar, scatter. Returns a permanent image URL. Combine with data tools (climate.co2, census.population, finance.exchange_rates) to visualize any dataset. Powered by QuickChart (Chart.js).", "inputSchema": { "type": "object", "properties": { "type": { "type": "string", "enum": [ "bar", "line", "pie", "doughnut", "radar", "scatter", "horizontalBar" ], "description": "Chart type: bar, line, pie, doughnut, radar, scatter, horizontalBar" }, "labels": { "type": "array", "items": { "type": "string" }, "description": "X-axis labels (e.g. [\"Q1\", \"Q2\", \"Q3\", \"Q4\"])" }, "datasets": { "type": "array", "items": { "type": "object", "properties": { "label": { "type": "string", "description": "Dataset label (e.g. \"Revenue\", \"Temperature\")" }, "data": { "type": "array", "items": { "type": "number" }, "description": "Array of numeric values" } }, "required": [ "label", "data" ] }, "description": "One or more datasets to plot", "minItems": 1 }, "title": { "type": "string", "description": "Chart title displayed at top" }, "width": { "type": "integer", "minimum": 100, "maximum": 1000, "description": "Image width in pixels (100-1000, default 500)" }, "height": { "type": "integer", "minimum": 100, "maximum": 1000, "description": "Image height in pixels (100-1000, default 300)" } }, "required": [ "type", "labels", "datasets" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "figi.finance.filter", "title": "Filter Financial Instruments", "description": "Filter financial instruments by exchange code, market sector (Equity/Corp/Govt/Index/Curncy/Comdty), or security type (Common Stock/ETP/REIT/ADR). Browse instrument universe by structured criteria. Bloomberg OpenFIGI.", "inputSchema": { "type": "object", "properties": { "exchange_code": { "type": "string", "description": "Exchange code (e.g. US, LN, HK, JP)" }, "market_sector": { "type": "string", "description": "Market sector (e.g. Equity, Corp, Govt, Index, Curncy, Comdty)" }, "security_type": { "type": "string", "description": "Security type (e.g. \"Common Stock\", \"ETP\", \"REIT\", \"ADR\")" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "figi.finance.map", "title": "Map Financial Identifier to FIGI", "description": "Resolve financial instrument identifiers \u2014 ISIN, CUSIP, SEDOL, or ticker symbol to Bloomberg FIGI (ISO 18774). Returns FIGI, composite FIGI, security name, type, and exchange. 300M+ instruments across 45K+ exchanges. Use ID_ISIN, ID_CUSIP, ID_SEDOL, or TICKER as id_type.", "inputSchema": { "type": "object", "properties": { "id_type": { "type": "string", "enum": [ "ID_ISIN", "ID_CUSIP", "ID_SEDOL", "ID_BB_GLOBAL", "TICKER", "ID_WERTPAPIER", "ID_COMMON" ], "description": "Identifier type: ID_ISIN, ID_CUSIP, ID_SEDOL, TICKER, ID_BB_GLOBAL" }, "id_value": { "type": "string", "description": "Identifier value (e.g. US0378331005 for ISIN, AAPL for ticker, BBG000B9XRY4 for FIGI)", "minLength": 1 }, "exchange_code": { "type": "string", "description": "Exchange code to narrow results (e.g. US, LN, JP). Optional." } }, "required": [ "id_type", "id_value" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "figi.finance.search", "title": "Search Financial Instruments", "description": "Search 300M+ financial instruments by company name or ticker keyword. Filter by exchange and security type. Returns Bloomberg FIGI, ticker, name, market sector. Covers equities, ETPs, bonds, derivatives globally.", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query \u2014 company name or ticker (e.g. \"Tesla\", \"Apple Inc\", \"MSFT\")", "minLength": 1 }, "exchange_code": { "type": "string", "description": "Filter by exchange code (e.g. US, LN, JP)" }, "security_type": { "type": "string", "description": "Filter by security type (e.g. \"Common Stock\", \"ETP\", \"REIT\")" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.edgar.xbrl_concept", "title": "SEC Company Financial History", "description": "Complete history of any XBRL financial concept (Revenues, NetIncomeLoss, Assets, EPS) for a company across all SEC filings. Returns up to 20 most recent values with period dates, form type, fiscal year. Free alternative to Bloomberg for historical financials.", "inputSchema": { "type": "object", "properties": { "cik": { "type": "string", "description": "SEC CIK number (e.g. \"320193\" for Apple, \"789019\" for Microsoft)", "minLength": 1 }, "tag": { "type": "string", "description": "XBRL concept tag (e.g. Revenues, NetIncomeLoss, Assets, EarningsPerShareBasic)", "minLength": 1 }, "taxonomy": { "type": "string", "description": "XBRL taxonomy (default: us-gaap). Other: ifrs-full, dei, srt" } }, "required": [ "cik", "tag" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.edgar.xbrl_frames", "title": "SEC Cross-Company Financial Comparison", "description": "Compare a financial metric across ALL SEC-reporting companies for a period. Query Revenues for CY2023 \u2192 2,649 companies with values. Top: Walmart $648B, UnitedHealth $371B. Free alternative to Bloomberg/FactSet. Period format: CY2023 (annual), CY2023Q4I (quarterly).", "inputSchema": { "type": "object", "properties": { "tag": { "type": "string", "description": "XBRL concept tag (e.g. Revenues, NetIncomeLoss, Assets, TotalDebt)", "minLength": 1 }, "period": { "type": "string", "description": "Reporting period: CY2023 (annual), CY2023Q4I (quarterly instant), CY2023Q3 (quarterly duration)", "minLength": 1 }, "unit": { "type": "string", "description": "Unit of measure (default: USD). Other: USD/shares for EPS, shares for share counts" }, "taxonomy": { "type": "string", "description": "XBRL taxonomy (default: us-gaap)" } }, "required": [ "tag", "period" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "usno.astronomy.moon_phases", "title": "Moon Phases", "description": "Get all moon phase dates for a year \u2014 New Moon, First Quarter, Full Moon, Last Quarter with exact UTC timestamps. ~50 phases per year. Source: US Naval Observatory (canonical astronomical authority, US Gov public domain).", "inputSchema": { "type": "object", "properties": { "year": { "type": "integer", "minimum": 1700, "maximum": 2100, "description": "Year for moon phases (default: current year, e.g. 2026)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "usno.astronomy.seasons", "title": "Equinoxes & Solstices", "description": "Get exact dates and UTC times for vernal equinox, summer solstice, autumnal equinox, and winter solstice for any year. Also includes Earth perihelion and aphelion dates. Source: US Naval Observatory.", "inputSchema": { "type": "object", "properties": { "year": { "type": "integer", "minimum": 1700, "maximum": 2100, "description": "Year for equinoxes and solstices (default: current year)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "usno.astronomy.sun_moon", "title": "Sun & Moon Rise/Set Times", "description": "Get sunrise, sunset, moonrise, moonset, and transit times for any location and date. Includes civil/nautical/astronomical twilight. Used for photography golden hour, agriculture planning, outdoor events. Source: USNO.", "inputSchema": { "type": "object", "properties": { "date": { "type": "string", "description": "Date in YYYY-MM-DD format (e.g. 2026-04-07)" }, "latitude": { "type": "number", "description": "Latitude in decimal degrees (e.g. 40.7128 for New York)", "minimum": -90, "maximum": 90 }, "longitude": { "type": "number", "description": "Longitude in decimal degrees (e.g. -74.0060 for New York)", "minimum": -180, "maximum": 180 } }, "required": [ "date", "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "wger.fitness.exercise_details", "title": "Exercise Details", "description": "Get full exercise details by ID \u2014 description, primary and secondary muscles worked, required equipment (barbell/dumbbell/bodyweight/machine), and category. Use with exercise_search to build workout plans.", "inputSchema": { "type": "object", "properties": { "id": { "type": "integer", "description": "Exercise base ID from search results (e.g. 615 for Squats)" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "wger.fitness.exercise_search", "title": "Exercise Search", "description": "Search 896 exercises by name \u2014 bench press, squat, deadlift, curl, etc. Returns exercise name, category (Chest/Back/Legs/Arms/Abs/Shoulders/Cardio), and ID for details lookup. Open-source fitness database (Wger, CC-BY-SA).", "inputSchema": { "type": "object", "properties": { "term": { "type": "string", "description": "Exercise name to search (e.g. \"bench press\", \"squat\", \"deadlift\", \"bicep curl\")", "minLength": 1 } }, "required": [ "term" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "wger.fitness.ingredients", "title": "Food Ingredient Nutrition", "description": "Search 1.28M food ingredients by name \u2014 chicken breast, rice, banana, oats. Returns calories (kcal), protein, carbs, fat, fiber, sugar, sodium per 100g. Complements USDA FDC with broader international coverage.", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Food ingredient name (e.g. \"chicken breast\", \"rice\", \"banana\", \"oats\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results (1-20, default 10)" } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "email.verification.check", "title": "Verify Email Address", "description": "Verify an email address \u2014 SMTP deliverability check, DNS/MX validation, disposable email detection, catch-all server detection, free provider flag, role account flag (info@, admin@). Returns comprehensive verification result. Powered by WhoisXML API.", "inputSchema": { "type": "object", "properties": { "email": { "type": "string", "description": "Email address to verify (e.g. user@example.com, test@gmail.com)", "minLength": 3 } }, "required": [ "email" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "solar.system.bodies", "title": "Solar System Bodies", "description": "List solar system bodies \u2014 planets, moons, asteroids, comets, dwarf planets. Returns name, body type, gravity, radius, and moon count. 1,400+ bodies. Filter by type. Source: Solar System OpenData (MIT license).", "inputSchema": { "type": "object", "properties": { "body_type": { "type": "string", "enum": [ "planet", "moon", "asteroid", "comet", "dwarf_planet", "all" ], "description": "Filter by body type: planet, moon, asteroid, comet, dwarf_planet, or all (default: all)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "solar.system.body_details", "title": "Solar System Body Details", "description": "Get comprehensive data for a solar system body \u2014 mass, radius, density, gravity, escape velocity, temperature, axial tilt, orbital period, semi-major axis, eccentricity, inclination, discoverer, and list of moons. Source: Solar System OpenData.", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "Body ID from search results (e.g. \"mars\", \"jupiter\", \"moon\", \"europa\", \"ceres\")", "minLength": 1 } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "iss.space.position", "title": "ISS Current Position", "description": "Get the real-time position of the International Space Station \u2014 latitude, longitude, altitude (km), velocity (km/h), and daylight/eclipse visibility. ISS orbits at 28,000 km/h, completes one orbit every 90 minutes. Updates every ~60 seconds.", "inputSchema": { "type": "object", "properties": { "units": { "type": "string", "enum": [ "kilometers", "miles" ], "description": "Distance units: kilometers (default) or miles" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "iss.space.tle", "title": "ISS Orbital Elements (TLE)", "description": "Get the Two-Line Element set (TLE) for the International Space Station \u2014 NORAD catalog #25544. Contains orbital parameters for trajectory prediction and satellite tracking calculations.", "inputSchema": { "type": "object", "properties": { "format": { "type": "string", "enum": [ "json", "text" ], "description": "Response format: json (default) or text (raw TLE two-line element)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "hf.hub.datasets", "title": "Search ML Datasets", "description": "Search 200K+ datasets on HuggingFace Hub by name or keyword. Returns dataset ID, downloads, likes, tags. Covers NLP, vision, audio, tabular datasets. Sorted by downloads.", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Search query \u2014 dataset name or keyword (e.g. \"wikipedia\", \"imagenet\", \"squad\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results (1-20, default 10)" } }, "required": [ "search" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "hf.hub.model_details", "title": "ML Model Details", "description": "Get full metadata for a HuggingFace model \u2014 downloads, likes, tags, library, author, pipeline task, model card data. Use model_id from hf.models search (e.g. \"meta-llama/Llama-3.3-70B-Instruct\").", "inputSchema": { "type": "object", "properties": { "model_id": { "type": "string", "description": "Full model ID (e.g. \"meta-llama/Llama-3.3-70B-Instruct\", \"stabilityai/stable-diffusion-xl-base-1.0\")", "minLength": 1 } }, "required": [ "model_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "hf.hub.models", "title": "Search ML Models", "description": "Search 1M+ ML models on HuggingFace Hub by name, task (text-generation, image-classification, translation), or library (transformers, diffusers). Returns model ID, downloads, likes, pipeline tag. Sorted by downloads.", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Search query \u2014 model name or keyword (e.g. \"llama\", \"stable-diffusion\", \"whisper\")", "minLength": 1 }, "task": { "type": "string", "description": "Filter by ML task: text-generation, image-classification, translation, text-to-image, automatic-speech-recognition, etc." }, "library": { "type": "string", "description": "Filter by framework: transformers, diffusers, sentence-transformers, gguf, etc." }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results (1-20, default 10)" } }, "required": [ "search" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "water.usgs.realtime", "title": "Real-Time Water Data", "description": "Get real-time streamflow (ft^3/s), gage height (ft), water temperature, and conductance for a USGS monitoring site. Updated every 15 minutes. Covers rivers, streams, lakes, reservoirs across the US. Use water.sites to find site numbers (USGS)", "inputSchema": { "type": "object", "properties": { "site_no": { "type": "string", "description": "USGS site number (e.g. \"09380000\"). Use water.sites to find site numbers first.", "minLength": 1 }, "parameter_cd": { "type": "string", "description": "Parameter code(s), comma-separated. Common: 00060=streamflow, 00065=gage height, 00010=temperature. Default: all available." }, "period": { "type": "string", "description": "ISO 8601 duration for data window (e.g. \"PT2H\" for 2 hours, \"P7D\" for 7 days). Default: PT2H." } }, "required": [ "site_no" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "water.usgs.sites", "title": "Search Water Monitoring Sites", "description": "Search 1.5M+ USGS water monitoring sites by US state, county FIPS, bounding box, or site number. Returns site ID, station name, coordinates, altitude, HUC watershed code. Use site numbers with water.realtime for live data (USGS)", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "US state FIPS code, 2 chars (e.g. \"CA\", \"NY\", \"CO\")" }, "county": { "type": "string", "description": "County FIPS code, 5 digits (e.g. \"06037\" for Los Angeles County)" }, "bbox": { "type": "string", "description": "Bounding box: west,south,east,north in decimal degrees (e.g. \"-105.5,39.5,-104.5,40.5\")" }, "site_no": { "type": "string", "description": "USGS site number (e.g. \"09380000\" for Colorado River at Lees Ferry)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "worldbank.dev.indicators", "title": "Search Development Indicators", "description": "Search 16,000+ World Bank development indicators by keyword or topic \u2014 GDP, population, poverty, education, health, environment, trade. Returns indicator ID, name, source, description, topics. Use indicator IDs with finance.country_data for time-series data (World Bank, CC BY 4.0)", "inputSchema": { "type": "object", "properties": { "keyword": { "type": "string", "description": "Search keyword for indicators (e.g. \"gdp\", \"population\", \"poverty\", \"education\", \"co2 emissions\")" }, "topic": { "type": "string", "description": "Topic ID filter (1=Agriculture, 3=Economy, 4=Education, 6=Environment, 8=Health, 11=Poverty, 14=Science, 19=Climate Change)" }, "source": { "type": "string", "description": "Source ID filter (2=World Development Indicators, 11=Africa, 57=Gender)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Results per page (1-50, default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "cdc.health.datasets", "title": "Search CDC Health Datasets", "description": "Search 1,400+ CDC public health datasets \u2014 COVID-19, chronic disease, vaccination, mortality, birth/death statistics, environmental health. Returns dataset ID, name, description, category. Use dataset IDs with cdc.query to fetch data (US Gov)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search keyword (e.g. \"covid deaths\", \"vaccination rates\", \"chronic disease\", \"mortality\")" }, "category": { "type": "string", "description": "Dataset category filter (e.g. \"NCHS\", \"COVID-19\", \"Chronic Disease Indicators\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "cdc.health.query", "title": "Query CDC Dataset", "description": "Query a specific CDC dataset using SoQL filters \u2014 filter by state, year, age group, condition. Returns structured rows with column names. Supports WHERE, SELECT, ORDER, GROUP BY. Use cdc.datasets to find dataset IDs first (US Gov, Socrata SODA API)", "inputSchema": { "type": "object", "properties": { "dataset_id": { "type": "string", "description": "CDC dataset ID in xxxx-xxxx format (e.g. \"9bhg-hcku\" for COVID deaths). Use cdc.datasets to find IDs." }, "where": { "type": "string", "description": "SoQL WHERE clause filter (e.g. \"state='CA'\", \"year > 2020\", \"age_group='65+'\")" }, "select": { "type": "string", "description": "Columns to return, comma-separated (e.g. \"state, year, deaths\"). Default: all columns." }, "order": { "type": "string", "description": "Sort order (e.g. \"year DESC\", \"deaths DESC\"). Default: dataset default order." }, "group": { "type": "string", "description": "Group by columns for aggregation (e.g. \"state\" with select \"state, SUM(deaths)\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 1000, "description": "Max rows to return (1-1000, default 100)" } }, "required": [ "dataset_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "dblp.cs.author", "title": "Search CS Authors", "description": "Search 3M+ computer science authors on DBLP. Returns author name, DBLP PID, profile URL, aliases, affiliations. Use for finding researchers, checking publication records, or discovering collaborators (DBLP, CC0)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Author name to search (e.g. \"Geoffrey Hinton\", \"Yann LeCun\", \"Ilya Sutskever\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 30, "description": "Number of results (1-30, default 10)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "dblp.cs.search", "title": "Search CS Papers", "description": "Search 7M+ computer science publications on DBLP by title, keyword, or topic. Returns title, authors, venue (NeurIPS, ICML, CVPR, ACL, etc.), year, DOI. The largest CS-specific bibliography \u2014 covers journals, conferences, and workshops (DBLP, CC0)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query \u2014 paper title, keyword, or topic (e.g. \"transformer attention\", \"graph neural network\", \"LLM reasoning\")", "minLength": 1 }, "year": { "type": "integer", "description": "Filter by publication year (e.g. 2024)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 20)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "tides.noaa.predictions", "title": "Tide Predictions", "description": "Get tide predictions for a NOAA station \u2014 high/low tides, hourly, or 6-minute intervals. Returns predicted water level in feet or meters. Covers US coastlines, rivers, Great Lakes. Station IDs: 8518750 (NYC), 9414290 (SF), 8443970 (Boston) (NOAA, US Gov)", "inputSchema": { "type": "object", "properties": { "station": { "type": "string", "description": "NOAA station ID (e.g. \"8518750\" for The Battery NYC, \"9414290\" for San Francisco, \"8443970\" for Boston)", "minLength": 1 }, "begin_date": { "type": "string", "description": "Start date in YYYYMMDD format (e.g. \"20260409\")" }, "end_date": { "type": "string", "description": "End date in YYYYMMDD format (e.g. \"20260410\"). Max range: 31 days." }, "interval": { "type": "string", "enum": [ "hilo", "h", "6" ], "description": "Prediction interval: \"hilo\" = high/low tides only (default), \"h\" = hourly, \"6\" = every 6 minutes" }, "datum": { "type": "string", "description": "Vertical datum: MLLW (default), MSL, NAVD, MHHW, MHW, MLW, etc." }, "units": { "type": "string", "enum": [ "english", "metric" ], "description": "Units: \"english\" = feet (default), \"metric\" = meters" } }, "required": [ "station", "begin_date", "end_date" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "tides.noaa.water_levels", "title": "Real-Time Water Levels", "description": "Get real-time observed water levels from a NOAA station \u2014 latest reading or recent history. Returns water level in feet or meters with quality flags. Updated every 6 minutes. Covers US coastlines, rivers, Great Lakes (NOAA, US Gov)", "inputSchema": { "type": "object", "properties": { "station": { "type": "string", "description": "NOAA station ID (e.g. \"8518750\" for The Battery NYC, \"9414290\" for San Francisco)", "minLength": 1 }, "date": { "type": "string", "description": "Date filter: \"latest\" (default, most recent reading), \"today\", \"recent\" (last 72 hours), or YYYYMMDD for specific date" }, "datum": { "type": "string", "description": "Vertical datum: MLLW (default), MSL, NAVD, MHHW, MHW, MLW, etc." }, "units": { "type": "string", "enum": [ "english", "metric" ], "description": "Units: \"english\" = feet (default), \"metric\" = meters" } }, "required": [ "station" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "met.art.details", "title": "Artwork Details", "description": "Get full details for a Met Museum artwork by object ID \u2014 title, artist, date, medium, dimensions, department, culture, provenance, high-res image URLs, public domain status. Use met.search to find object IDs first (Met Museum, CC0)", "inputSchema": { "type": "object", "properties": { "object_id": { "type": "integer", "description": "Met Museum object ID (e.g. 436524 for Van Gogh Sunflowers, 45734 for Washington Crossing the Delaware). Use met.search to find IDs.", "minimum": 1 } }, "required": [ "object_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "met.art.search", "title": "Search Met Museum Artworks", "description": "Search 470,000+ artworks at The Metropolitan Museum of Art by keyword, artist, medium, department, date range, or geography. Returns object IDs \u2014 use met.details for full metadata and images. CC0 public domain (Met Museum)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search keyword \u2014 artist, title, medium, or subject (e.g. \"monet\", \"sunflowers\", \"greek vase\", \"armor\")", "minLength": 1 }, "department_id": { "type": "integer", "description": "Department filter: 1=American Decorative Arts, 3=Ancient Near Eastern Art, 6=Asian Art, 9=Drawings and Prints, 11=European Paintings, 13=Greek and Roman Art, 17=Medieval Art, 21=Modern Art" }, "medium": { "type": "string", "description": "Medium filter (e.g. \"Paintings\", \"Sculpture\", \"Photographs\", \"Ceramics\")" }, "has_images": { "type": "boolean", "description": "Only return artworks with images (default: true)" }, "geo_location": { "type": "string", "description": "Geographic location filter (e.g. \"France\", \"Japan\", \"Egypt\")" }, "date_begin": { "type": "integer", "description": "Start year for date range filter (e.g. 1800). Use with date_end." }, "date_end": { "type": "integer", "description": "End year for date range filter (e.g. 1900). Use with date_begin." } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "rijks.art.details", "title": "Rijksmuseum Artwork Details", "description": "Get full details for a Rijksmuseum artwork by object ID \u2014 title (multiple languages), object number, creation date, production location, materials, dimensions, current gallery location. Linked Art JSON-LD format (CIDOC CRM). Use rijks.search to find object IDs first (Rijksmuseum, CC-BY)", "inputSchema": { "type": "object", "properties": { "object_id": { "type": "string", "description": "Rijksmuseum numeric ID (e.g. \"200107928\" for The Night Watch). Use rijks.search to find IDs.", "minLength": 1 } }, "required": [ "object_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "rijks.art.search", "title": "Search Rijksmuseum Collection", "description": "Search 800,000+ artworks at the Rijksmuseum (Dutch national museum) by title, description, creation date, or object number. Returns Linked Open Data object IDs \u2014 use rijks.details for full metadata. Covers Rembrandt, Vermeer, Van Gogh, and centuries of Dutch art. CC-BY license (Rijksmuseum)", "inputSchema": { "type": "object", "properties": { "title": { "type": "string", "description": "Artwork title search (e.g. \"Night Watch\", \"Self-portrait\", \"Milkmaid\")" }, "description": { "type": "string", "description": "Search within artwork descriptions (e.g. \"portrait\", \"landscape\")" }, "creation_date": { "type": "string", "description": "Filter by creation year or date (e.g. \"1642\", \"1665\")" }, "object_number": { "type": "string", "description": "Rijksmuseum object number (e.g. \"SK-C-5\" for Night Watch)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "cma.art.details", "title": "CMA Artwork Details", "description": "Get full details for a Cleveland Museum artwork by ID \u2014 title, artist, nationality, date, medium, dimensions, culture, provenance, license status (CC0/restricted), image URLs (web + full resolution). Use cma.search to find artwork IDs first (CMA, CC0)", "inputSchema": { "type": "object", "properties": { "artwork_id": { "type": "integer", "description": "Cleveland Museum artwork ID (e.g. 135382 for Monet \"The Red Kerchief\"). Use cma.search to find IDs.", "minimum": 1 } }, "required": [ "artwork_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "cma.art.search", "title": "Search Cleveland Museum Collection", "description": "Search 64,000+ artworks at the Cleveland Museum of Art by keyword, artist, type, or department. Filter for CC0-only (commercial-free) images. Returns artwork IDs, title, artist, date, license status, image URLs. Use cma.artwork for full details (CMA, CC0)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search keyword \u2014 artist, title, subject (e.g. \"monet\", \"armor\", \"japanese\")" }, "type": { "type": "string", "description": "Artwork type filter (e.g. \"Painting\", \"Sculpture\", \"Print\", \"Photograph\")" }, "department": { "type": "string", "description": "Department filter (e.g. \"European Painting and Sculpture\", \"Asian Art\", \"Prints\")" }, "artist": { "type": "string", "description": "Artist name filter (e.g. \"Claude Monet\", \"Pablo Picasso\")" }, "cc0_only": { "type": "boolean", "description": "Only return CC0-licensed artworks (free for commercial use). Default: false." }, "has_image": { "type": "boolean", "description": "Only return artworks with images (default: true)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "smithsonian.collection.record", "title": "Smithsonian Record Details", "description": "Get full record for a Smithsonian Open Access item by ID \u2014 title, unit code (which of 19 museums), license (CC0 flag), record_link (canonical URL), data_source, online media (images/audio/video), freetext metadata, indexed structured fields. Use smithsonian.search to find IDs first (Smithsonian, CC0 subset)", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "Smithsonian record ID from a previous search result (e.g. \"edanmdm-nmnhvz_5068559\" or \"ld1-*\"). Use smithsonian.search first to find IDs.", "minLength": 1 } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "smithsonian.collection.search", "title": "Search Smithsonian Collections", "description": "Full-text search across 11M+ records from 19 Smithsonian museums \u2014 art, artifacts, scientific specimens, archives. Filter by type (objects/species/archives/books/online_media/events/places), sort by relevancy/newest/updated/random, and CC0-only by default. Covers National Museum of Natural History, Air and Space, American Art, Portrait Gallery, Freer|Sackler, and more (Smithsonian Open Access, CC0 subset)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Full-text search query. Example: \"dinosaur\", \"picasso\", \"apollo 11\". Supports EDAN query syntax (field:value, AND/OR).", "minLength": 1 }, "rows": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of results to return (1-100, default 10)." }, "start": { "type": "integer", "minimum": 0, "description": "Offset for pagination (default 0). Useful with rowCount from previous call." }, "sort": { "type": "string", "enum": [ "relevancy", "newest", "updated", "random" ], "description": "Sort order for results. Default: relevancy." }, "type": { "type": "string", "enum": [ "archives", "books", "online_media", "objects", "events", "places", "species" ], "description": "Filter by record type. E.g. \"objects\" for 3D objects, \"species\" for scientific specimens." }, "online_media_type": { "type": "string", "enum": [ "Images", "Sound recordings", "Videos" ], "description": "Filter to items that have media of a specific type." }, "cc0_only": { "type": "boolean", "description": "Filter results to CC0-licensed records only (default true). Set false to include all records with their license field." } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "soil.survey.properties", "title": "Soil Properties by Location", "description": "Get USDA SSURGO soil properties for a US location by lat/lon (WGS84). Returns dominant component(s) with depth-stratified horizons including drainage class, taxonomic class, pH, organic matter %, and sand/silt/clay percentages per horizon. Coverage: US continental + Alaska + Hawaii + territories; international/water/unsurveyed points return empty components array. Authoritative source: NRCS Soil Data Access (no auth, unlimited free, US Gov open data)", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude in WGS84 decimal degrees (e.g. 42.0 for central Iowa farmland, 38.89 for Washington DC). Coverage: US continental + Alaska + Hawaii + territories.", "minimum": -90, "maximum": 90 }, "lon": { "type": "number", "description": "Longitude in WGS84 decimal degrees (e.g. -93.5 for central Iowa, -77.03 for Washington DC). Note: longitude FIRST in coordinate pairs only matters for SQL \u2014 this field is independent.", "minimum": -180, "maximum": 180 } }, "required": [ "lat", "lon" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "phone.telnyx.balance", "title": "Account Balance (Telnyx)", "description": "Read current Telnyx account balance, available credit, currency, pending charges, and credit limit. Useful for cost monitoring before placing high-volume sends (Telnyx)", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "Set to true to bypass the 30-second cache and fetch a fresh balance from Telnyx. Default false." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "phone.telnyx.list", "title": "List Messages (Telnyx)", "description": "List recent Telnyx messages with optional filters: direction (inbound/outbound), date_from (ISO 8601), and pagination limit (max 100). Returns array of {message_id, from, to, text, status, created_at, cost} (Telnyx)", "inputSchema": { "type": "object", "properties": { "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max number of messages to return per page (default 25, max 100)." }, "direction": { "type": "string", "enum": [ "inbound", "outbound" ], "description": "Filter by message direction: \"outbound\" (sent by us) or \"inbound\" (received)." }, "date_from": { "type": "string", "description": "ISO 8601 date \u2014 return messages created on or after this date (e.g. \"2026-04-26\")." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "phone.telnyx.status", "title": "Message Status (Telnyx)", "description": "Get delivery status and events for a previously sent Telnyx message by message UUID. Returns per-recipient status (queued/sending/sent/delivered/failed), parts, sent_at, completed_at, errors, and cost (Telnyx)", "inputSchema": { "type": "object", "properties": { "message_id": { "type": "string", "description": "Telnyx message UUID returned by send_sms (e.g. \"40ab7e80-94c6-4cb6-8c45-c3ed3e3bf3ec\").", "minLength": 1 } }, "required": [ "message_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "phone.telnyx.estimate", "title": "Estimate SMS Tier + Price (Telnyx)", "description": "Classify a destination phone number into the right pricing tier (na / world / premium) and return the recommended send tool and price. Use this BEFORE telnyx.send_sms_* to avoid 400 errors. $0.001/lookup (Telnyx)", "inputSchema": { "type": "object", "properties": { "to": { "type": "string", "description": "Destination phone number in E.164 format (e.g. \"+14155551234\", \"+447911123456\", \"+79991234567\"). The classifier returns the recommended send tool and tier-based price.", "minLength": 1 } }, "required": [ "to" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "phone.telnyx.sms_na", "title": "Send SMS \u2014 NANP (Telnyx)", "description": "\u26a1 ACTION: Send SMS to North America (NANP +1 \u2014 US, Canada, Caribbean). $0.012/message \u2014 cheapest tier. Returns 400 if destination is outside +1. Use telnyx.estimate_price first if unsure (Telnyx)", "inputSchema": { "type": "object", "properties": { "to": { "type": "string", "description": "Recipient phone number in E.164 format (e.g. \"+14155551234\"). Trial accounts can only send to verified destination numbers added in the Telnyx portal.", "minLength": 1 }, "from": { "type": "string", "description": "Sender phone number in E.164 format \u2014 must be a Telnyx number you own (e.g. \"+15551234567\"). Provision via Telnyx portal Numbers > Buy Numbers.", "minLength": 1 }, "text": { "type": "string", "description": "SMS body text (max 1600 chars; >160 splits into multiple billing segments).", "minLength": 1, "maxLength": 1600 }, "messaging_profile_id": { "type": "string", "description": "Optional Telnyx messaging profile UUID to route through a specific profile (10DLC campaign, sender pool)." } }, "required": [ "to", "from", "text" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "phone.telnyx.sms_premium", "title": "Send SMS \u2014 Premium (Telnyx)", "description": "\u26a1 ACTION: Send SMS to high-cost destinations: Russia +7, Belarus +375, Ukraine +380, China +86, Turkey +90, MENA (SA/AE/EG/JO/...), Africa (NG/KE/ZA/...), and any unknown prefix (default). $0.25/message. Highest tier \u2014 use telnyx.estimate_price to verify before sending (Telnyx)", "inputSchema": { "type": "object", "properties": { "to": { "type": "string", "description": "Recipient phone number in E.164 format (e.g. \"+14155551234\"). Trial accounts can only send to verified destination numbers added in the Telnyx portal.", "minLength": 1 }, "from": { "type": "string", "description": "Sender phone number in E.164 format \u2014 must be a Telnyx number you own (e.g. \"+15551234567\"). Provision via Telnyx portal Numbers > Buy Numbers.", "minLength": 1 }, "text": { "type": "string", "description": "SMS body text (max 1600 chars; >160 splits into multiple billing segments).", "minLength": 1, "maxLength": 1600 }, "messaging_profile_id": { "type": "string", "description": "Optional Telnyx messaging profile UUID to route through a specific profile (10DLC campaign, sender pool)." } }, "required": [ "to", "from", "text" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "phone.telnyx.sms_world", "title": "Send SMS \u2014 World (Telnyx)", "description": "\u26a1 ACTION: Send SMS to most international destinations: UK +44, EU (DE/FR/IT/ES/NL/PL...), AU +61, JP +81, IN +91, BR +55, MX +52, ZA +27, IL +972, AE +971, SG +65, KR +82. $0.10/message. Returns 400 if destination is in NA tier (use telnyx.send_sms_na) or premium tier (use telnyx.send_sms_premium) (Telnyx)", "inputSchema": { "type": "object", "properties": { "to": { "type": "string", "description": "Recipient phone number in E.164 format (e.g. \"+14155551234\"). Trial accounts can only send to verified destination numbers added in the Telnyx portal.", "minLength": 1 }, "from": { "type": "string", "description": "Sender phone number in E.164 format \u2014 must be a Telnyx number you own (e.g. \"+15551234567\"). Provision via Telnyx portal Numbers > Buy Numbers.", "minLength": 1 }, "text": { "type": "string", "description": "SMS body text (max 1600 chars; >160 splits into multiple billing segments).", "minLength": 1, "maxLength": 1600 }, "messaging_profile_id": { "type": "string", "description": "Optional Telnyx messaging profile UUID to route through a specific profile (10DLC campaign, sender pool)." } }, "required": [ "to", "from", "text" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "space.swpc.aurora", "title": "Aurora Forecast (NOAA SWPC)", "description": "Latest OVATION aurora visibility forecast aggregated into 10-degree latitude bands. Returns observation/forecast times plus top northern and southern hemisphere bands by max aurora probability \u2014 useful for aurora-tourism agents and high-latitude visibility checks. Source: NOAA SWPC (NODD public domain)", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "No-op flag for cache busting. Set to true to bypass the 5-minute cache and fetch the latest aurora oval forecast." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "space.swpc.k_index", "title": "Geomagnetic K-index (NOAA SWPC)", "description": "Current planetary K-index with G1-G5 storm severity classification, plus the maximum K-index observed in the rolling 6-hour window. Returns latest reading, window_max, and the last N 1-minute observations. Source: NOAA SWPC real-time stream (NODD public domain)", "inputSchema": { "type": "object", "properties": { "points": { "type": "integer", "minimum": 1, "maximum": 120, "description": "Number of recent 1-minute K-index readings to return alongside the latest reading (default 30, max 120). The full 6-hour rolling window is always scanned for the window_max field regardless of this value." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "space.swpc.solar_regions", "title": "Active Solar Regions (NOAA SWPC)", "description": "Currently active sunspot regions with NOAA AR number, location (heliographic), area, spot class, magnetic class, and 24-hour C/M/X-class flare probabilities. Sorted by most recently observed first. Source: NOAA SWPC (NODD public domain)", "inputSchema": { "type": "object", "properties": { "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max number of active sunspot regions to return, sorted by most recently observed first (default 20, max 50). Each entry includes NOAA AR number, location, magnetic class, and C/M/X-class flare probabilities." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "space.swpc.solar_wind", "title": "Solar Wind Real-time (NOAA SWPC)", "description": "Real-time solar wind speed (km/s), proton density (per cm\u00b3), and temperature (K) from the ACE/DSCOVR L1 monitors. Returns the latest reading plus the last N 1-minute observations. Source: NOAA SWPC RTSW (NODD public domain)", "inputSchema": { "type": "object", "properties": { "points": { "type": "integer", "minimum": 1, "maximum": 60, "description": "Number of recent 1-minute solar-wind readings to return alongside the latest reading (default 20, max 60). Each reading includes proton speed (km/s), density (per cm\u00b3), temperature (K), and quality score." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.bcb.cdi", "title": "CDI Daily Rate (BCB)", "description": "Brazilian CDI daily rate (series 12) \u2014 last N observations from BCB SGS. ODbL", "inputSchema": { "type": "object", "properties": { "last_n": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of most recent observations to return (default 30, max 500). For daily series this is days; for monthly (IPCA) it is months." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.bcb.eur_brl", "title": "EUR/BRL Daily FX (BCB)", "description": "Brazilian Real / Euro daily exchange rate (series 21619) \u2014 last N observations from BCB SGS. ODbL", "inputSchema": { "type": "object", "properties": { "last_n": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of most recent observations to return (default 30, max 500). For daily series this is days; for monthly (IPCA) it is months." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.bcb.ipca", "title": "IPCA Monthly Inflation (BCB)", "description": "Brazilian IPCA monthly inflation rate (series 433) \u2014 last N observations from BCB SGS. ODbL", "inputSchema": { "type": "object", "properties": { "last_n": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of most recent observations to return (default 30, max 500). For daily series this is days; for monthly (IPCA) it is months." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.bcb.selic", "title": "SELIC Daily Rate (BCB)", "description": "Brazilian SELIC daily interest rate (series 11) \u2014 last N observations from BCB SGS. ODbL", "inputSchema": { "type": "object", "properties": { "last_n": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of most recent observations to return (default 30, max 500). For daily series this is days; for monthly (IPCA) it is months." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.bcb.selic_target", "title": "SELIC Target Rate (COPOM)", "description": "COPOM-set SELIC target rate (series 4389) \u2014 Brazilian central bank policy decisions. BCB SGS ODbL", "inputSchema": { "type": "object", "properties": { "last_n": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of most recent observations to return (default 30, max 500). For daily series this is days; for monthly (IPCA) it is months." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.bcb.usd_brl", "title": "USD/BRL Daily FX (BCB)", "description": "Brazilian Real / US Dollar daily exchange rate (series 1) \u2014 last N observations from BCB SGS. ODbL", "inputSchema": { "type": "object", "properties": { "last_n": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of most recent observations to return (default 30, max 500). For daily series this is days; for monthly (IPCA) it is months." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "bible.catalog.books", "title": "List Books in Bible Translation", "description": "List the books in a specific Bible translation (e.g. KJV \u2192 66 books). Returns book IDs and chapter counts needed for bible.passage. Free Use Bible API", "inputSchema": { "type": "object", "properties": { "translation": { "type": "string", "description": "Bible translation ID (e.g. \"KJV\", \"ASV\", \"WEB\", \"BSB\"). Use bible.translations to discover IDs.", "minLength": 1 } }, "required": [ "translation" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "bible.catalog.commentaries", "title": "List Bible Commentaries", "description": "List available scholarly Bible commentaries (Matthew Henry, JFB, Gill, etc.). Each entry includes commentary ID, name, and language. Free Use Bible API", "inputSchema": { "type": "object", "properties": { "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max commentaries to return (default 50, max 100)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "bible.text.passage", "title": "Get Bible Chapter Text", "description": "Fetch the verse-by-verse text of a Bible chapter for a given translation and book (e.g. KJV / John / 3). Returns array of {number, text}. Free Use Bible API", "inputSchema": { "type": "object", "properties": { "translation": { "type": "string", "description": "Bible translation ID (e.g. \"KJV\", \"ASV\", \"WEB\", \"BSB\").", "minLength": 1 }, "book": { "type": "string", "description": "Book ID \u2014 typically a 3-letter code (e.g. \"GEN\", \"JHN\", \"PSA\") or full name. Use bible.books to discover.", "minLength": 1 }, "chapter": { "type": "integer", "description": "Chapter number (1-based, e.g. 3 for John 3).", "minimum": 1 } }, "required": [ "translation", "book", "chapter" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "bible.catalog.translations", "title": "List Bible Translations", "description": "List 1000+ public-domain Bible translations across 429+ languages. Filter by ISO 639-3 language code or English name. Returns translation IDs needed for bible.passage. MIT-licensed open data (Free Use Bible API)", "inputSchema": { "type": "object", "properties": { "language": { "type": "string", "description": "Optional ISO 639-3 language code (e.g. \"eng\", \"spa\", \"fra\") or English language name substring (e.g. \"Spanish\") to filter the 1000+ translations." }, "limit": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Max translations to return (default 50, max 200)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.brasilapi.banks", "title": "Brazilian Banks", "description": "List all 472 Brazilian banks with ISPB codes and bank numbers. BrasilAPI MIT", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "Set to true to bypass cache and re-fetch the list of 472 Brazilian banks with ISPB codes." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.brasilapi.cep", "title": "Brazilian CEP Lookup", "description": "Look up a Brazilian address by 8-digit CEP postal code \u2014 returns street, neighborhood, city, state, coordinates, timezone. BrasilAPI MIT", "inputSchema": { "type": "object", "properties": { "cep": { "type": "string", "description": "Brazilian postal code (CEP) \u2014 8 digits with or without dash (e.g. \"01001000\" or \"01001-000\"). Returns street, neighborhood, city, state, coords, timezone.", "minLength": 8 } }, "required": [ "cep" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.brasilapi.cnpj", "title": "Brazilian CNPJ Lookup", "description": "Look up a Brazilian company by 14-digit CNPJ tax ID \u2014 returns name, address, CNAE codes, QSA partners, capital, status from Receita Federal. BrasilAPI MIT", "inputSchema": { "type": "object", "properties": { "cnpj": { "type": "string", "description": "Brazilian company tax ID (CNPJ) \u2014 14 digits with or without punctuation (e.g. \"33000167000101\" or \"33.000.167/0001-01\"). Returns full Receita Federal company registry data.", "minLength": 14 } }, "required": [ "cnpj" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.brasilapi.ddd", "title": "Brazilian DDD Area Code", "description": "Look up Brazilian area code (DDD, 2 digits) \u2192 state and cities. BrasilAPI MIT", "inputSchema": { "type": "object", "properties": { "ddd": { "type": "integer", "description": "Brazilian area code (DDD) \u2014 2 digits (e.g. 11 for S\u00e3o Paulo, 21 for Rio de Janeiro).", "minimum": 11, "maximum": 99 } }, "required": [ "ddd" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.brasilapi.holidays", "title": "Brazilian Holidays", "description": "All Brazilian national holidays for a given year. BrasilAPI MIT", "inputSchema": { "type": "object", "properties": { "year": { "type": "integer", "description": "Year (e.g. 2026). Returns all Brazilian national holidays for that year.", "minimum": 1900, "maximum": 2100 } }, "required": [ "year" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.brasilapi.rates", "title": "Brazilian Interest Rates", "description": "Current SELIC, CDI, and IPCA rates from Banco Central do Brasil. BrasilAPI MIT", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "Set to true to bypass cache and re-fetch current SELIC, CDI, and IPCA rates." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.eurostat.gdp_growth", "title": "EU Annual GDP Growth", "description": "Annual real GDP growth rate (chain-linked volumes, % change vs previous year) for one EU country. Eurostat dataset tec00115, CC BY 4.0", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Eurostat geo code \u2014 2-letter country (DE, FR, IT, ES, UK, PL, ...) or aggregate (\"EU27_2020\", \"EA20\"). One country per call. Default: \"EU27_2020\"." }, "since": { "type": "string", "description": "Earliest period to return \u2014 format depends on series frequency: \"2020\" (annual), \"2024-01\" (monthly), \"2024Q1\" (quarterly)." }, "until": { "type": "string", "description": "Latest period to return \u2014 same format as `since`." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.eurostat.inflation", "title": "EU Monthly Inflation (HICP)", "description": "Monthly HICP annual rate of change (overall index) for one EU country. Eurostat dataset prc_hicp_manr, CC BY 4.0", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Eurostat geo code \u2014 2-letter country (DE, FR, IT, ES, UK, PL, ...) or aggregate (\"EU27_2020\", \"EA20\"). One country per call. Default: \"EU27_2020\"." }, "since": { "type": "string", "description": "Earliest period to return \u2014 format depends on series frequency: \"2020\" (annual), \"2024-01\" (monthly), \"2024Q1\" (quarterly)." }, "until": { "type": "string", "description": "Latest period to return \u2014 same format as `since`." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.eurostat.population", "title": "EU Annual Population", "description": "Annual population on 1 January for one EU country. Eurostat dataset demo_gind, CC BY 4.0", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Eurostat geo code \u2014 2-letter country (DE, FR, IT, ES, UK, PL, ...) or aggregate (\"EU27_2020\", \"EA20\"). One country per call. Default: \"EU27_2020\"." }, "since": { "type": "string", "description": "Earliest period to return \u2014 format depends on series frequency: \"2020\" (annual), \"2024-01\" (monthly), \"2024Q1\" (quarterly)." }, "until": { "type": "string", "description": "Latest period to return \u2014 same format as `since`." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.eurostat.unemployment", "title": "EU Monthly Unemployment", "description": "Monthly unemployment rate (% of active population, seasonally adjusted, total population) for one EU country (geo code) or aggregate (EU27_2020, EA20). Eurostat dataset une_rt_m, CC BY 4.0", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Eurostat geo code \u2014 2-letter country (DE, FR, IT, ES, UK, PL, ...) or aggregate (\"EU27_2020\", \"EA20\"). One country per call. Default: \"EU27_2020\"." }, "since": { "type": "string", "description": "Earliest period to return \u2014 format depends on series frequency: \"2020\" (annual), \"2024-01\" (monthly), \"2024Q1\" (quarterly)." }, "until": { "type": "string", "description": "Latest period to return \u2014 same format as `since`." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "books.gutendex.book", "title": "Project Gutenberg Book Detail", "description": "Get full metadata + download URLs (EPUB, TXT, HTML, cover JPEG) for a Project Gutenberg book by numeric ID (e.g. 1342 = Pride and Prejudice). Gutendex MIT", "inputSchema": { "type": "object", "properties": { "book_id": { "type": "integer", "description": "Project Gutenberg book ID (e.g. 1342 for Pride and Prejudice, 11 for Alice in Wonderland).", "minimum": 1 } }, "required": [ "book_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "books.gutendex.by_author", "title": "Books by Author (Gutendex)", "description": "List all Project Gutenberg books by a specific author (search by name). Filter by language. Gutendex MIT", "inputSchema": { "type": "object", "properties": { "author": { "type": "string", "description": "Author name search (e.g. \"Jane Austen\", \"Mark Twain\", \"Tolstoy\").", "minLength": 1 }, "language": { "type": "string", "description": "Optional ISO 639-1 language code to filter by language (e.g. \"en\")." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max results to return (default 20, max 50)." } }, "required": [ "author" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "books.gutendex.popular", "title": "Popular Public-Domain Books", "description": "List most-downloaded Project Gutenberg books, optionally filtered by language or topic. Gutendex MIT", "inputSchema": { "type": "object", "properties": { "language": { "type": "string", "description": "Optional ISO 639-1 language code to filter (e.g. \"en\")." }, "topic": { "type": "string", "description": "Optional subject/bookshelf to filter (e.g. \"Adventure\")." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max results to return (default 20, max 50)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "books.gutendex.search", "title": "Search Project Gutenberg", "description": "Search 78K+ public-domain books on Project Gutenberg by free-text query, language (ISO 639-1), topic, or author birth year. Returns book IDs, titles, authors, languages, subjects, download counts, and EPUB/TXT/HTML/cover URLs (Gutendex MIT)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Free-text search across title, author name, and subject (e.g. \"shakespeare\", \"moby dick\")." }, "language": { "type": "string", "description": "ISO 639-1 language code or comma-separated codes to filter by language (e.g. \"en\", \"fr,de\")." }, "topic": { "type": "string", "description": "Subject/bookshelf topic filter (e.g. \"Adventure\", \"Children's literature\")." }, "author_year_start": { "type": "integer", "description": "Filter by author birth year \u2014 only include books from authors alive in this period start." }, "author_year_end": { "type": "integer", "description": "Filter by author birth year \u2014 only include books from authors alive up to this year." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max results to return (default 20, max 50)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.ibge.cnae", "title": "CNAE Economic Activity Classes", "description": "Brazilian CNAE economic activity classification codes used in CNPJ and tax filings. IBGE CC BY 4.0", "inputSchema": { "type": "object", "properties": { "limit": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Max CNAE economic activity classes to return (default 100, max 500)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.ibge.municipalities", "title": "Brazilian Municipalities", "description": "List all 5,570 Brazilian municipalities (or filtered by 2-letter state code) with IBGE codes. IBGE CC BY 4.0", "inputSchema": { "type": "object", "properties": { "uf": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Optional 2-letter Brazilian state code (e.g. \"SP\" for S\u00e3o Paulo, \"RJ\" for Rio de Janeiro). If omitted, returns all 5,570 municipalities." }, "limit": { "type": "integer", "minimum": 1, "maximum": 2000, "description": "Max municipalities to return (default 200, max 2000 \u2014 useful for pagination)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.ibge.name_frequency", "title": "Brazilian Name Frequency", "description": "First-name popularity time-series by decade since 1930 from Brazilian census data \u2014 useful for cultural/marketing research. IBGE CC BY 4.0", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "First name (e.g. \"MARIA\", \"JOSE\"). Returns name frequency time-series by decade since 1930 from Brazilian census data.", "minLength": 1 } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.ibge.regions", "title": "Brazilian Regions", "description": "The 5 Brazilian geographic regions (Norte, Nordeste, Sudeste, Sul, Centro-Oeste) with metadata. IBGE CC BY 4.0", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "Set to true to bypass cache and fetch the 5 Brazilian geographic regions (Norte, Nordeste, etc.)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.ibge.states", "title": "Brazilian States", "description": "All 27 Brazilian states + Federal District with full region hierarchy. IBGE CC BY 4.0", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "Set to true to bypass cache and fetch all 27 Brazilian states + DF with region hierarchy." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "books.librivox.book", "title": "LibriVox Audiobook Detail", "description": "Get full audiobook details by LibriVox ID \u2014 includes per-section MP3 URLs (chapter-level streaming), playtimes, authors, and project metadata. LibriVox public domain", "inputSchema": { "type": "object", "properties": { "book_id": { "type": "integer", "description": "LibriVox audiobook ID (integer). Use librivox.search first to discover IDs. Returns full chapter list with MP3 URLs.", "minimum": 1 } }, "required": [ "book_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "books.librivox.search", "title": "Search LibriVox Audiobooks", "description": "Search 20K+ public-domain audiobooks by title, author, or genre. Returns book IDs, descriptions, languages, copyright years, total time, and ZIP download URLs. LibriVox public domain", "inputSchema": { "type": "object", "properties": { "title": { "type": "string", "description": "Substring search on audiobook title (e.g. \"pride and prejudice\", \"treasure\")." }, "author": { "type": "string", "description": "Author name search (e.g. \"shakespeare\", \"twain\", \"tolstoy\")." }, "genre": { "type": "string", "description": "Genre filter \u2014 e.g. \"Adventure\", \"Children's Fiction\", \"Mystery\", \"Plays\", \"Poetry\"." }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max results to return (default 25, max 100)." }, "offset": { "type": "integer", "minimum": 0, "description": "Pagination offset for stepping through large result sets." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.loc.collections", "title": "List LOC Collections", "description": "Browse Library of Congress digital collections \u2014 Civil War Photographs, Geography & Map Division, Rosa Parks Papers, etc. Returns collection slugs needed for filtered search. LOC public domain", "inputSchema": { "type": "object", "properties": { "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max collections to return (default 20, max 50)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.loc.item", "title": "LOC Item Detail", "description": "Get full metadata + asset URLs (image, audio, PDF) for a Library of Congress item by its ID or full LOC URL. Includes rights, contributors, subjects, and digitized resource list. LOC public domain", "inputSchema": { "type": "object", "properties": { "item_id": { "type": "string", "description": "Library of Congress item ID or full LOC URL (e.g. \"item/2003675333\" or \"https://www.loc.gov/item/2003675333/\"). Returns metadata + asset URLs.", "minLength": 1 } }, "required": [ "item_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "media.loc.search", "title": "Search Library of Congress", "description": "Search 415K+ digitized historical items at LOC (photos, manuscripts, maps, newspapers, films, rare books). Filter by online format (image/audio/video/text/web archive) or collection slug. Public domain by US statute (17 USC \u00a7105)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Free-text search across LOC's 415K+ digitized items (e.g. \"civil war\", \"suffrage\", \"lincoln\").", "minLength": 1 }, "format": { "type": "string", "enum": [ "image", "audio", "film, video", "online text", "web archive" ], "description": "Optional filter by online format \u2014 image, audio, film/video, online text, or web archive." }, "collection": { "type": "string", "description": "Optional collection slug to scope the search (e.g. \"rosa-parks-papers\")." }, "page": { "type": "integer", "minimum": 1, "description": "Page number for pagination (1-based)." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Results per page (default 20, max 50)." } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.sg.air_quality", "title": "SG PM2.5 Air Quality", "description": "Real-time PM2.5 readings (\u03bcg/m\u00b3) for the 5 Singapore regions (north/south/east/west/central). NEA, SG Open Data Licence v1.0", "inputSchema": { "type": "object", "properties": { "date": { "type": "string", "description": "Optional ISO 8601 date (YYYY-MM-DD) or datetime to query historical data. If omitted, returns the latest snapshot." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.sg.rainfall", "title": "SG Rainfall Stations", "description": "5-minute rainfall readings (mm) from 60 NEA weather stations across Singapore with station coords. SG Open Data Licence v1.0", "inputSchema": { "type": "object", "properties": { "date": { "type": "string", "description": "Optional ISO 8601 date (YYYY-MM-DD) or datetime to query historical data. If omitted, returns the latest snapshot." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.sg.taxi_availability", "title": "SG Live Taxi Density", "description": "Live taxi positions across Singapore aggregated to a 5km grid \u2014 returns the top 30 zones by taxi count and the timestamp of the snapshot. LTA, SG Open Data Licence v1.0", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "Set to true to bypass cache and re-fetch the latest snapshot." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.sg.weather_forecast", "title": "SG 2-Hour Weather Forecast", "description": "Real-time 2-hour weather forecast for 51 Singapore zones (showers/cloudy/etc.) from NEA. Singapore Open Data Licence v1.0", "inputSchema": { "type": "object", "properties": { "date": { "type": "string", "description": "Optional ISO 8601 date (YYYY-MM-DD) or datetime to query historical data. If omitted, returns the latest snapshot." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "language.tatoeba.languages", "title": "Tatoeba Supported Languages", "description": "List all 429 supported languages on Tatoeba with ISO 639-3 codes and sentence counts. Tatoeba CC-BY 2.0 FR", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "Set to true to bypass cache and fetch the latest list of supported languages with sentence counts." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "language.tatoeba.search", "title": "Search Tatoeba Sentences", "description": "Search 13M parallel sentences across 429 languages (CC-BY 2.0 FR). Filter by source language, optional translation language, audio availability, and free-text keyword. Sort by relevance/random/created/modified. Tatoeba", "inputSchema": { "type": "object", "properties": { "language": { "type": "string", "description": "ISO 639-3 language code of the source sentence (default \"eng\"). Use tatoeba.languages to discover codes." }, "query": { "type": "string", "description": "Optional keyword search inside sentence text." }, "translation_lang": { "type": "string", "description": "ISO 639-3 code of a target language \u2014 only return sentences that have a translation into this language." }, "has_audio": { "type": "boolean", "description": "Filter to sentences that have a human audio recording attached." }, "sort": { "type": "string", "enum": [ "relevance", "words", "created", "modified", "random" ], "description": "Sort order \u2014 \"relevance\" (default), \"words\" (length), \"created\", \"modified\", or \"random\"." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max sentences to return (default 10, max 50)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "language.tatoeba.sentence", "title": "Tatoeba Sentence Detail", "description": "Get a single Tatoeba sentence by ID with all translations and audio recordings. Useful for language-learning agents. Tatoeba CC-BY 2.0 FR", "inputSchema": { "type": "object", "properties": { "sentence_id": { "type": "integer", "description": "Tatoeba sentence ID. Returns the sentence with all translations and audio recordings.", "minimum": 1 } }, "required": [ "sentence_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.ukpolice.crimes_near", "title": "UK Crimes Near Coordinate", "description": "Street-level UK crime records within 1 mile of a coordinate for a given month (England + Wales, 43 forces). Filter by crime category. Returns up to 500 records with category, location, outcome status. OGL v3.0 (commercial OK)", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude (e.g. 51.5074 for central London). UK area only." }, "lng": { "type": "number", "description": "Longitude (e.g. -0.1278 for central London)." }, "date": { "type": "string", "description": "Month in YYYY-MM format (e.g. \"2024-06\"). Defaults to latest available month if omitted." }, "category": { "type": "string", "description": "Crime category slug \u2014 \"all-crime\" (default), \"burglary\", \"violent-crime\", \"drugs\", \"robbery\", \"shoplifting\", \"vehicle-crime\", \"anti-social-behaviour\", etc." }, "limit": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Max crime records to return (default 100, max 500)." } }, "required": [ "lat", "lng" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.ukpolice.forces", "title": "UK Police Forces", "description": "List the 43 UK police forces (id + name) for England and Wales. Used to drill down into per-force statistics. OGL v3.0", "inputSchema": { "type": "object", "properties": { "refresh": { "type": "boolean", "description": "Set to true to bypass cache and re-fetch the list of 43 UK police forces." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.ukpolice.outcomes", "title": "UK Crime Outcomes at Location", "description": "Case outcomes (charged, acquitted, action taken, etc.) for crimes at a UK coordinate in a given month. Useful for property safety scoring. OGL v3.0", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude of the location to query (e.g. 51.5074)." }, "lng": { "type": "number", "description": "Longitude of the location to query (e.g. -0.1278)." }, "date": { "type": "string", "description": "Month in YYYY-MM format. Defaults to latest available month." }, "limit": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Max outcome records to return (default 100, max 500)." } }, "required": [ "lat", "lng" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "weather.airnow.current_latlng", "title": "Current AQI by Coordinate (AirNow)", "description": "Current AQI observations near a US coordinate. Same fields as current_zip. EPA AirNow", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude (decimal degrees, e.g. 40.7128 for NYC)." }, "lng": { "type": "number", "description": "Longitude (decimal degrees, e.g. -74.0060 for NYC)." }, "distance": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Search radius in miles around the coordinate (default 25)." } }, "required": [ "lat", "lng" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "weather.airnow.current_zip", "title": "Current AQI by ZIP (AirNow)", "description": "Current Air Quality Index (AQI) observations from EPA AirNow for any US ZIP code. Returns PM2.5, ozone, AQI value + category (Good/Moderate/Unhealthy/...). US Gov free", "inputSchema": { "type": "object", "properties": { "zip": { "type": "string", "description": "US ZIP code \u2014 5 digits (e.g. \"10001\" Manhattan, \"90210\" Beverly Hills, \"60601\" Chicago).", "minLength": 5, "maxLength": 5 }, "distance": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Search radius in miles around the ZIP centroid (default 25). If no monitor within radius, returns empty array." } }, "required": [ "zip" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "weather.airnow.forecast_latlng", "title": "AQI Forecast by Coordinate (AirNow)", "description": "Multi-day AQI forecast for a US lat/lng. EPA AirNow", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude (decimal degrees, e.g. 40.7128 for NYC)." }, "lng": { "type": "number", "description": "Longitude (decimal degrees, e.g. -74.0060 for NYC)." }, "distance": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Search radius in miles around the coordinate (default 25)." }, "date": { "type": "string", "description": "Optional ISO date YYYY-MM-DD to get forecast for that day. Default: today." } }, "required": [ "lat", "lng" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "weather.airnow.forecast_zip", "title": "AQI Forecast by ZIP (AirNow)", "description": "Multi-day AQI forecast (today + ~5 days) for a US ZIP \u2014 ozone + PM2.5 expected category. EPA AirNow", "inputSchema": { "type": "object", "properties": { "zip": { "type": "string", "description": "US ZIP code \u2014 5 digits (e.g. \"10001\" Manhattan, \"90210\" Beverly Hills, \"60601\" Chicago).", "minLength": 5, "maxLength": 5 }, "distance": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Search radius in miles around the ZIP centroid (default 25). If no monitor within radius, returns empty array." }, "date": { "type": "string", "description": "Optional ISO date YYYY-MM-DD to get forecast for that day. Default: today." } }, "required": [ "zip" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.eia.electricity", "title": "US Retail Electricity (EIA)", "description": "Retail electricity sales/price/revenue by US state and sector (residential, commercial, industrial). Frequency monthly/quarterly/annual. EIA public domain, 5K req/hr", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Optional 2-letter US state code (e.g. \"CA\", \"TX\", \"NY\"). If omitted, returns national + all states." }, "frequency": { "type": "string", "enum": [ "monthly", "quarterly", "annual" ], "description": "Time frequency (default \"monthly\")." }, "length": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of recent observations to return (default 24, max 500)." }, "start": { "type": "string", "description": "Earliest period (e.g. \"2020-01\" monthly, \"2020\" annual)." }, "end": { "type": "string", "description": "Latest period in same format as `start`." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.eia.natural_gas", "title": "US Natural Gas Prices (EIA)", "description": "Natural gas residential/commercial/industrial prices by US state. EIA public domain", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Optional 2-letter US state code." }, "frequency": { "type": "string", "enum": [ "monthly", "annual" ], "description": "Time frequency (default \"monthly\")." }, "length": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of recent observations (default 24, max 500)." }, "start": { "type": "string", "description": "Earliest period." }, "end": { "type": "string", "description": "Latest period." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.eia.petroleum", "title": "US Petroleum Spot Prices (EIA)", "description": "Spot prices for crude oil and petroleum products: WTI (EPCWTI), Brent (EPCBRENT), Diesel (EPD2D), Regular Gas (EPMRR). Daily/weekly/monthly/annual. EIA public domain", "inputSchema": { "type": "object", "properties": { "product": { "type": "string", "description": "Petroleum product code \u2014 e.g. \"EPCBRENT\" (Brent), \"EPCWTI\" (WTI), \"EPD2D\" (No. 2 Diesel), \"EPMRR\" (Regular Gas)." }, "frequency": { "type": "string", "enum": [ "daily", "weekly", "monthly", "annual" ], "description": "Time frequency (default \"daily\" for spot prices)." }, "length": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of recent observations (default 24, max 500)." }, "start": { "type": "string", "description": "Earliest period (ISO date or YYYY-MM-DD)." }, "end": { "type": "string", "description": "Latest period." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "finance.eia.series", "title": "EIA Total-Energy Series", "description": "Direct fetch of any EIA total-energy time-series by series ID (e.g. RNGWHHD = Henry Hub spot, ELETPUS = US electricity total). EIA public domain", "inputSchema": { "type": "object", "properties": { "series_id": { "type": "string", "description": "EIA series ID for the total-energy dataset (e.g. \"RNGWHHD\" Henry Hub spot, \"ELETPUS\" total US electricity, \"TETCBUS\" total energy consumption).", "minLength": 1 }, "frequency": { "type": "string", "enum": [ "monthly", "annual" ], "description": "Time frequency (default \"monthly\")." }, "length": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Number of recent observations (default 24, max 500)." } }, "required": [ "series_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.fec.candidates", "title": "FEC Candidates", "description": "Search 53K+ US federal election candidates by name/cycle/office (House/Senate/Presidential)/state/party. Returns FEC candidate ID + filing dates. FEC public disclosure", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Free-text candidate name search (e.g. \"Sanders\", \"Trump\")." }, "cycle": { "type": "integer", "description": "Election cycle year \u2014 even number (e.g. 2024, 2022, 2020)." }, "office": { "type": "string", "enum": [ "H", "S", "P" ], "description": "Office: \"H\" House of Representatives, \"S\" Senate, \"P\" Presidential." }, "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "2-letter state code (e.g. \"CA\", \"TX\")." }, "party": { "type": "string", "description": "Party abbreviation (e.g. \"REP\", \"DEM\", \"LIB\", \"GRE\")." }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)." }, "per_page": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Per-page count (default 20, max 100)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.fec.committee_totals", "title": "FEC Committee Totals", "description": "Receipts, disbursements, and cash-on-hand for US political committees (PACs, parties, candidate committees). Filter by cycle and committee type. FEC public disclosure", "inputSchema": { "type": "object", "properties": { "cycle": { "type": "integer", "description": "Election cycle year (e.g. 2024)." }, "committee_type": { "type": "string", "description": "Committee type code: \"P\" Presidential, \"H\" House, \"S\" Senate, \"X\" Party, \"Y\" Party-Qualified, \"N\" PAC, \"Q\" PAC-Qualified, \"O\" Super PAC." }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)." }, "per_page": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Per-page count (default 20, max 100)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.fec.elections", "title": "FEC Election Totals", "description": "Aggregate election totals by cycle, office, and state \u2014 total receipts, disbursements, candidate count per race. FEC public disclosure", "inputSchema": { "type": "object", "properties": { "cycle": { "type": "integer", "description": "Election cycle year (e.g. 2024)." }, "office": { "type": "string", "enum": [ "H", "S", "P" ], "description": "Office: \"H\" House, \"S\" Senate, \"P\" Presidential." }, "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "2-letter state code." }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)." }, "per_page": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Per-page count (default 20, max 100)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "gov.fec.super_pac_spending", "title": "Super PAC Independent Expenditures (FEC)", "description": "Schedule E independent expenditures \u2014 Super PAC spending supporting/opposing specific federal candidates. Filter by cycle, candidate ID, or support/oppose direction. FEC public disclosure", "inputSchema": { "type": "object", "properties": { "cycle": { "type": "integer", "description": "Election cycle year (e.g. 2024)." }, "candidate_id": { "type": "string", "description": "FEC candidate ID (from fec.candidates) \u2014 return only expenditures targeting this candidate." }, "support_oppose": { "type": "string", "enum": [ "S", "O" ], "description": "\"S\" support / \"O\" oppose. If omitted, both directions returned." }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)." }, "per_page": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Per-page count (default 20, max 100)." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "travel.nps.alerts", "title": "NPS Park Alerts", "description": "Real-time alerts (closures, hazards, fire, flood, danger) for US national parks. Filter by state or park code. NPS public domain", "inputSchema": { "type": "object", "properties": { "state_code": { "type": "string", "description": "Optional 2-letter US state code (e.g. \"CA\", \"NY\", \"WY\"). Comma-separated for multiple (\"CA,WY\")." }, "park_code": { "type": "string", "description": "Optional park code (e.g. \"yose\" Yosemite, \"yell\" Yellowstone, \"grca\" Grand Canyon). Comma-separated allowed." }, "q": { "type": "string", "description": "Free-text keyword search." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max records to return (default 10, max 50)." }, "start": { "type": "integer", "minimum": 0, "description": "Pagination offset for stepping through results." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "travel.nps.campgrounds", "title": "NPS Campgrounds", "description": "NPS campgrounds with reservation info, accessibility, amenities, coords. NPS public domain", "inputSchema": { "type": "object", "properties": { "state_code": { "type": "string", "description": "Optional 2-letter US state code (e.g. \"CA\", \"NY\", \"WY\"). Comma-separated for multiple (\"CA,WY\")." }, "park_code": { "type": "string", "description": "Optional park code (e.g. \"yose\" Yosemite, \"yell\" Yellowstone, \"grca\" Grand Canyon). Comma-separated allowed." }, "q": { "type": "string", "description": "Free-text keyword search." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max records to return (default 10, max 50)." }, "start": { "type": "integer", "minimum": 0, "description": "Pagination offset for stepping through results." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "travel.nps.parks", "title": "US National Parks", "description": "Search the 474 US national parks with full metadata: coords, activities, entrance fees, operating hours, photos, designation. Filter by state code, park code, or keyword. NPS public domain", "inputSchema": { "type": "object", "properties": { "state_code": { "type": "string", "description": "Optional 2-letter US state code (e.g. \"CA\", \"NY\", \"WY\"). Comma-separated for multiple (\"CA,WY\")." }, "park_code": { "type": "string", "description": "Optional park code (e.g. \"yose\" Yosemite, \"yell\" Yellowstone, \"grca\" Grand Canyon). Comma-separated allowed." }, "q": { "type": "string", "description": "Free-text keyword search." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max records to return (default 10, max 50)." }, "start": { "type": "integer", "minimum": 0, "description": "Pagination offset for stepping through results." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "travel.nps.things_to_do", "title": "NPS Things To Do", "description": "Activities, programs, tours offered at US national parks (3,587 entries). Filter by park or state. NPS public domain", "inputSchema": { "type": "object", "properties": { "state_code": { "type": "string", "description": "Optional 2-letter US state code (e.g. \"CA\", \"NY\", \"WY\"). Comma-separated for multiple (\"CA,WY\")." }, "park_code": { "type": "string", "description": "Optional park code (e.g. \"yose\" Yosemite, \"yell\" Yellowstone, \"grca\" Grand Canyon). Comma-separated allowed." }, "q": { "type": "string", "description": "Free-text keyword search." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max records to return (default 10, max 50)." }, "start": { "type": "integer", "minimum": 0, "description": "Pagination offset for stepping through results." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false } }, { "name": "razorpay.ifsc.lookup", "title": "Razorpay IFSC Bank Lookup", "description": "Look up Indian bank branch details (name, address, IFSC capabilities like UPI/NEFT/RTGS/IMPS) by IFSC code. Free, MIT-licensed open data covering all Indian banks.", "inputSchema": { "type": "object", "properties": { "ifsc_code": { "type": "string", "description": "11-character IFSC code (e.g. SBIN0005943). Format: 4 letters (bank code) + 0 + 6 digits (branch code).", "minLength": 11, "maxLength": 11 } }, "required": [ "ifsc_code" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "lichess.puzzle.daily", "title": "Lichess Daily Puzzle", "description": "Get today's Lichess daily puzzle \u2014 puzzle ID, FEN position, solution moves, theme, rating difficulty.", "inputSchema": { "type": "object", "properties": { "_unused": { "type": "string", "description": "Reserved for future filtering \u2014 not currently used." } } }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "lichess.players.top", "title": "Lichess Top Players", "description": "Top N players in a chess variant (bullet, blitz, rapid, classical, ultraBullet, chess960, crazyhouse, antichess, atomic, horde, kingOfTheHill, racingKings, threeCheck). Returns username, rating, country.", "inputSchema": { "type": "object", "properties": { "nb": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Number of top players to return (1\u2013200). Defaults to 10.", "default": 10 }, "perf_type": { "type": "string", "enum": [ "bullet", "blitz", "rapid", "classical", "ultraBullet", "chess960", "crazyhouse", "antichess", "atomic", "horde", "kingOfTheHill", "racingKings", "threeCheck" ], "description": "Chess variant to rank players by. One of: bullet, blitz, rapid, classical, ultraBullet, chess960, crazyhouse, antichess, atomic, horde, kingOfTheHill, racingKings, threeCheck." } }, "required": [ "perf_type" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "lichess.user.profile", "title": "Lichess User Profile", "description": "Get a Lichess user's profile \u2014 username, ratings across variants (bullet/blitz/rapid/classical/correspondence/puzzle), games played, online status, profile bio, country, language.", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "Lichess username (2\u201330 characters, lowercase letters, digits, and underscores). Example: \"DrNykterstein\".", "minLength": 2, "maxLength": 30 } }, "required": [ "username" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chesscom.player.profile", "title": "Chess.com Player Profile", "description": "Get a Chess.com player's profile \u2014 username, country, title (GM/IM/FM), join date, online status, followers, league. Distinct from Lichess: Chess.com is the world's largest chess platform with 100M+ users.", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "Chess.com username (3\u201325 characters; lowercase letters, digits, hyphens, and underscores only). Example: \"hikaru\", \"magnuscarlsen\".", "minLength": 3, "maxLength": 25 } }, "required": [ "username" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chesscom.player.stats", "title": "Chess.com Player Stats", "description": "Get a Chess.com player's rating + record across all time controls (rapid, blitz, bullet, daily, daily960, tactics, lessons, puzzle_rush). Returns highest rating, current rating, win/loss/draw counts.", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "Chess.com username (3\u201325 characters; lowercase letters, digits, hyphens, and underscores only). Example: \"hikaru\", \"magnuscarlsen\".", "minLength": 3, "maxLength": 25 } }, "required": [ "username" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chesscom.players.titled", "title": "Chess.com Titled Players List", "description": "List all titled players on Chess.com by title (GM, WGM, IM, WIM, FM, WFM, NM, WNM, CM, WCM). Returns array of usernames.", "inputSchema": { "type": "object", "properties": { "title": { "type": "string", "enum": [ "GM", "WGM", "IM", "WIM", "FM", "WFM", "NM", "WNM", "CM", "WCM" ], "description": "Official chess title to filter by. GM = Grandmaster, WGM = Woman Grandmaster, IM = International Master, WIM = Woman International Master, FM = FIDE Master, WFM = Woman FIDE Master, NM = National Master, WNM = Woman National Master, CM = Candidate Master, WCM = Woman Candidate Master." } }, "required": [ "title" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "aviation.metar.current", "title": "Aviation METAR Weather Report", "description": "Current METAR (METeorological Aerodrome Report) for one or more airports \u2014 official aviation weather observations (wind, visibility, sky condition, temperature, dewpoint, altimeter, remarks). Updates every 1 hour, more often when conditions change rapidly.", "inputSchema": { "type": "object", "properties": { "icao_codes": { "type": "string", "description": "Comma-separated ICAO airport codes (uppercase, 4 letters each, e.g. 'KJFK,KLAX,EGLL,RJTT'). Max 20 per call. Examples: KJFK (New York JFK), EGLL (London Heathrow), RJTT (Tokyo Haneda)." }, "hours": { "type": "integer", "minimum": 1, "maximum": 72, "description": "Hours of history to return (default 2, max 72)", "default": 2 } }, "required": [ "icao_codes" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "aviation.sigmet.alerts", "title": "Aviation SIGMET / AIRMET Hazard Alerts", "description": "Active SIGMET (SIGnificant METeorological information) and AIRMET reports \u2014 flight safety hazards including thunderstorms, turbulence, icing, volcanic ash, dust storms, mountain obscuration. Used by pilots and dispatchers for go/no-go decisions.", "inputSchema": { "type": "object", "properties": { "_unused": { "type": "string", "description": "Reserved for future hazard-type filtering" } } }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "aviation.taf.forecast", "title": "Aviation TAF Terminal Forecast", "description": "TAF (Terminal Aerodrome Forecast) for an airport \u2014 aviation forecast valid for next 24-30 hours with wind, visibility, weather phenomena, and sky conditions in 6-hour windows. Updates 4\u00d7 daily.", "inputSchema": { "type": "object", "properties": { "icao_codes": { "type": "string", "description": "Comma-separated ICAO airport codes. Max 20 per call. Examples: KJFK (New York JFK), EGLL (London Heathrow), OMDB (Dubai International), YSSY (Sydney Kingsford Smith)." } }, "required": [ "icao_codes" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ukfsa.establishments.detail", "title": "UK FSA Food Business Details", "description": "Detailed record for one UK food premise by FSA ID \u2014 full scheme breakdown (hygiene/structural/management scores), confidence in management score, exact inspection date, local authority code, business type taxonomy.", "inputSchema": { "type": "object", "properties": { "establishment_id": { "type": "integer", "description": "FSA establishment ID (positive integer, obtained from establishment_search results).", "minimum": 0 } }, "required": [ "establishment_id" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ukfsa.establishments.search", "title": "UK FSA Food Business Search", "description": "Search UK food businesses by name, address, postcode, or local authority. Returns the official Food Hygiene Rating Scheme score (0-5), business type, last inspection date, and full address. Covers 500K+ premises across England, Wales, Northern Ireland (Scotland has separate FHIS \u2014 pass/improvement required).", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Business name fragment to search (e.g. 'Tesco', 'Pret', 'Wagamama'). Partial match supported." }, "address": { "type": "string", "description": "Address or postcode fragment (e.g. 'SW1A 1AA', 'Manchester', 'Oxford Street')." }, "latitude": { "type": "number", "description": "WGS84 latitude for location-based search (use with longitude + max_distance_miles)." }, "longitude": { "type": "number", "description": "WGS84 longitude for location-based search." }, "max_distance_miles": { "type": "integer", "minimum": 0, "maximum": 100, "description": "Search radius from lat/lon in miles (0-100, default 5).", "default": 5 }, "page_size": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Results per page (1-50, default 20).", "default": 20 }, "page_number": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Page number for pagination (1-200, default 1).", "default": 1 } } }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ukfsa.authorities.list", "title": "UK FSA Local Authorities", "description": "List all UK local authorities that participate in the Food Hygiene Rating Scheme (or Scottish FHIS) \u2014 name, code, total establishments count, scheme type (FHRS=England/Wales/NI 0-5 rating, FHIS=Scotland pass/improvement).", "inputSchema": { "type": "object", "properties": { "_unused": { "type": "string", "description": "Reserved for future filtering \u2014 not currently used." } } }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "govuk.content.fetch", "title": "GOV.UK Document Content", "description": "Fetch full content of a GOV.UK page by its base path \u2014 title, publication date, organisation, full HTML body (or structured fields per content type), related documents.", "inputSchema": { "type": "object", "properties": { "base_path": { "type": "string", "description": "GOV.UK URL path starting with /, e.g. '/income-tax-rates' or '/government/publications/spring-statement-2026'. Get from govuk.search results." } }, "required": [ "base_path" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "govuk.organisations.list", "title": "GOV.UK Organisations Directory", "description": "List or search UK government organisations (ministerial departments, executive agencies, NDPBs, public corporations) \u2014 name, web URL, parent department, child organisations. 1100+ entries from Cabinet Office to local agencies.", "inputSchema": { "type": "object", "properties": { "page": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Page number (1-100, default 1, 20 organisations per page).", "default": 1 } } }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "govuk.content.search", "title": "GOV.UK Content Search", "description": "Full-text search across all 700K+ GOV.UK documents \u2014 guidance pages, news articles, statistics releases, organisation pages, ministerial pages, statutory instruments. Filter by content type, organisation, topic. Distinct from UK FSA (food ratings only) \u2014 this covers ALL government publications.", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search query (free text). Examples: 'energy bill rebate', 'visa skilled worker', 'income tax allowance 2026'." }, "count": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Results per page (1-100, default 10).", "default": 10 }, "start": { "type": "integer", "minimum": 0, "description": "Offset for pagination (default 0).", "default": 0 }, "order": { "type": "string", "enum": [ "-public_timestamp", "public_timestamp", "relevance", "-relevance" ], "description": "Sort order. Default is relevance. Use '-public_timestamp' for newest first, 'public_timestamp' for oldest first." } }, "required": [ "q" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "scb.catalog.browse", "title": "SCB Sweden Statistics Catalog", "description": "Browse the SCB statistics database tree by path. Top-level categories: BE (population), AM (labour market), HE (households), NR (national accounts), PR (prices/inflation), MI (environment), AA (general), BO (housing), EN (energy), FM (financial markets), HA (trade), JO (agriculture), LE (living conditions). Returns child nodes (subcategories, type=l) or table descriptors at leaf nodes (type=t). Use empty path '' to get top-level. Navigate hierarchically to find tables for scb.table_metadata.", "inputSchema": { "type": "object", "properties": { "path": { "type": "string", "description": "Hierarchical path through SCB taxonomy. Empty '' gets top-level categories. Examples: 'BE' (population), 'BE/BE0101' (population statistics tables), 'AM' (labour market), 'NR' (national accounts), 'PR' (prices/inflation), 'MI' (environment), 'HE' (household finances). Use scb.catalog recursively to navigate until type=t (table leaf) nodes appear.", "default": "" } } }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "scb.tables.metadata", "title": "SCB Sweden Table Metadata", "description": "Get metadata for a specific SCB statistical table \u2014 title, dimensions (variables like Region, Alder/age, Kon/sex, Tid/year), valid value codes for each dimension, and latest update timestamp. Use this BEFORE scb.table_query to discover what filter values are accepted. Example path: 'BE/BE0101/BE0101A/BefolkningNy' (Sweden population by region/age/sex/year).", "inputSchema": { "type": "object", "properties": { "table_path": { "type": "string", "description": "Full path to a leaf table (type='t' from scb.catalog), e.g. 'BE/BE0101/BE0101A/BefolkningNy' (Sweden population by region/age/sex/year). 'AM/AKU/AKU01/AKU01A' (labour market, employed persons). Returns title, dimension codes, and valid values to use in scb.table_query." } }, "required": [ "table_path" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "scb.tables.query", "title": "SCB Sweden Table Query", "description": "Run a statistical query against an SCB table \u2014 specify dimension filters to slice data by region, age, sex, year, etc. Returns JSON-stat2 format with labeled dimensions and numeric values. Always call scb.table_metadata first to discover valid dimension codes and value codes. Example: Sweden total population (Region='00', filter='vs:RegionRiket99'), latest year (Tid filter='top' values=['1']).", "inputSchema": { "type": "object", "properties": { "table_path": { "type": "string", "description": "Full path to the leaf table to query \u2014 same as scb.table_metadata table_path. Example: 'BE/BE0101/BE0101A/BefolkningNy'." }, "query": { "type": "array", "items": { "type": "object", "properties": { "code": { "type": "string", "description": "Dimension code from scb.table_metadata variables[].code. Examples: 'Region', 'Alder', 'Kon', 'Tid', 'ContentsCode'." }, "selection": { "type": "object", "properties": { "filter": { "type": "string", "description": "Filter type. Common values: 'item' (select by exact code), 'vs:RegionRiket99' (Sweden total), 'vs:RegionKommun07' (municipality level), 'top' (select N most recent \u2014 use with Tid/year dimensions), 'all' (all values). Use the valueSet codes from metadata." }, "values": { "type": "array", "items": { "type": "string" }, "description": "Array of value codes to select. Get valid codes from scb.table_metadata variables[].values. For filter='item': list codes like ['00','01']. For filter='top': list count like ['3'] (3 most recent). For filter='all': use ['*']. Example: Region '00' = Sweden total, Kon '1'=men '2'=women." } }, "required": [ "filter", "values" ], "description": "Selection criteria for this dimension." } }, "required": [ "code", "selection" ], "description": "Filter for one dimension (variable) in the table." }, "description": "Array of dimension filters. Each filter selects which values to include for one dimension. Example: [{code:'Region',selection:{filter:'vs:RegionRiket99',values:['00']}}, {code:'ContentsCode',selection:{filter:'item',values:['BE0101N1']}}, {code:'Tid',selection:{filter:'top',values:['1']}}]. Response is JSON-stat2 format with dimension labels and numeric values array." } }, "required": [ "table_path", "query" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "irctc.stations.search", "title": "IRCTC Railway Station Lookup", "description": "Search Indian Railways stations by name or partial code. Returns station code, full name, state. Use this to discover station codes for irctc.train_search/status.", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Station name fragment or partial station code to search for. Case-insensitive. Examples: \"Mumbai\" returns CSMT/BCT/LTT/etc., \"delhi\" returns NDLS/DLI/NZM, \"HWH\" returns Howrah. Returns up to 20 matches." } }, "required": [ "query" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "irctc.trains.search", "title": "IRCTC Train Search Between Stations", "description": "Search trains running between two Indian railway stations. Returns train number, name, departure/arrival time, distance, class availability (1A/2A/3A/SL/CC/EC), and running days (Mon-Sun).", "inputSchema": { "type": "object", "properties": { "from_station_code": { "type": "string", "description": "Origin station code (3-5 uppercase letters). Examples: NDLS (New Delhi), CSMT (Mumbai CST), HWH (Howrah Kolkata), MAS (Chennai Central), SBC (Bengaluru)." }, "to_station_code": { "type": "string", "description": "Destination station code (3-5 uppercase letters, same format as from_station_code). Use irctc.station_search to discover codes by name." }, "date_of_journey": { "type": "string", "description": "Journey date in YYYY-MM-DD format. Must be within the next 120 days from today. Example: 2026-05-15." } }, "required": [ "from_station_code", "to_station_code", "date_of_journey" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "irctc.trains.status", "title": "IRCTC Live Train Running Status", "description": "Get live running status of an Indian train for today or a specific date \u2014 current station, expected arrival/departure, delay in minutes, distance covered, full station-by-station schedule.", "inputSchema": { "type": "object", "properties": { "train_number": { "type": "string", "description": "5-digit Indian Railways train number. Examples: '12951' (Mumbai Rajdhani Express), '12303' (Poorva Express), '22691' (Rajdhani Express Bangalore)." }, "start_day": { "type": "integer", "minimum": 0, "maximum": 4, "description": "Day offset for the train journey start relative to today (0=today, 1=yesterday, 2=two days ago, up to 4). Use non-zero for multi-day trains that departed before today.", "default": 0 } }, "required": [ "train_number" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "nvd.cpes.search", "title": "NIST NVD CPE Product Lookup", "description": "Search the Common Platform Enumeration (CPE) dictionary for product identifiers used by CVEs. Returns CPE 2.3 URI (cpe:2.3:a:vendor:product:version:...), title, deprecation status. Use this to find the exact CPE string before searching CVEs by affected product.", "inputSchema": { "type": "object", "properties": { "keyword": { "type": "string", "description": "Product keyword to search the CPE dictionary. Examples: 'openssl', 'apache tomcat', 'nginx 1.18'. Returns CPE 2.3 URIs used to identify affected products in CVE records." }, "results_per_page": { "type": "integer", "minimum": 1, "maximum": 1000, "description": "Number of CPE records to return per page. Range: 1\u20131000. Default: 20." }, "start_index": { "type": "integer", "minimum": 0, "description": "Zero-based offset for pagination. Use with results_per_page to page through large result sets. Default: 0." } }, "required": [ "keyword" ], "description": "Search the CPE dictionary to find product identifiers used in CVE configurations." }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "nvd.cves.detail", "title": "NIST NVD CVE Detail", "description": "Fetch the canonical NVD record for a specific CVE-ID \u2014 full English description, CVSS v3 + v2 vectors and scores, weakness types (CWE), affected CPE configurations with version ranges, and all references with tags. Example: CVE-2021-44228 for Log4Shell.", "inputSchema": { "type": "object", "properties": { "cve_id": { "type": "string", "description": "Full CVE identifier in canonical form (e.g. 'CVE-2021-44228' for Log4Shell). Format: CVE-YYYY-NNNN+ where YYYY is the year and NNNN+ is a sequence number of four or more digits." } }, "required": [ "cve_id" ], "description": "Fetch the canonical NVD record for a single CVE by its ID." }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "nvd.cves.search", "title": "NIST NVD CVE Search", "description": "Search the National Vulnerability Database for CVE records by keyword, vendor, product, CVSS severity, or publication date range. Returns CVE-ID, summary, CVSS v3 base score, severity (LOW/MEDIUM/HIGH/CRITICAL), affected CPE configurations, references. Distinct from OSV: NVD provides canonical NIST records with CVSS v3 scores, CWE weakness types, and CPE configurations.", "inputSchema": { "type": "object", "properties": { "keyword": { "type": "string", "description": "Free-text keyword to search CVE records. Examples: 'log4j', 'OpenSSL CVE-2023', 'Linux kernel use-after-free'. Combined with other filters using AND logic." }, "cvss_v3_severity": { "type": "string", "enum": [ "LOW", "MEDIUM", "HIGH", "CRITICAL" ], "description": "Filter by CVSS v3 base severity. LOW = 0.1\u20133.9, MEDIUM = 4.0\u20136.9, HIGH = 7.0\u20138.9, CRITICAL = 9.0\u201310.0. Omit to return all severities." }, "pub_start_date": { "type": "string", "description": "Earliest CVE publication date in ISO 8601 extended format with timezone offset (e.g. '2024-01-01T00:00:00.000+00:00'). Maximum 120-day window per request when combined with pub_end_date." }, "pub_end_date": { "type": "string", "description": "Latest CVE publication date in ISO 8601 extended format with timezone offset (e.g. '2024-12-31T23:59:59.999+00:00'). Must be paired with pub_start_date. Maximum 120-day window." }, "results_per_page": { "type": "integer", "minimum": 1, "maximum": 2000, "description": "Number of CVE records to return per page. Range: 1\u20132000. Default: 20." }, "start_index": { "type": "integer", "minimum": 0, "description": "Zero-based offset for pagination. Use with results_per_page to page through large result sets. Default: 0." } }, "description": "Search NVD CVE records by keyword, severity, or date range." }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "usajobs.codes.list", "title": "USAJOBS Reference Code Lists", "description": "Fetch reference code lists used by USAJOBS \u2014 agency codes, pay grades, hiring paths, occupational series, security clearance levels, work schedules. Use to discover valid values for search filters.", "inputSchema": { "type": "object", "properties": { "code_list": { "type": "string", "enum": [ "agencysubelements", "occupationalseries", "hiringpaths", "securityclearances", "applicantsuppliers", "geoloccodes", "postalcodes", "cyberworkroles" ], "description": "Reference code list name. Options: agencysubelements (all federal agencies and sub-orgs), occupationalseries (4-digit job-family codes, e.g. 2210=IT Specialist), hiringpaths (public/veteran/student/disability/internal), securityclearances (Public Trust to TS/SCI), applicantsuppliers (hiring authority types), geoloccodes (geographic location codes), postalcodes (ZIP code lookup), cyberworkroles (NICE Cybersecurity Workforce Framework roles)." } }, "required": [ "code_list" ], "description": "Fetch reference code lists used by USAJOBS \u2014 agency codes, pay grades, hiring paths, occupational series, and more." }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "usajobs.positions.detail", "title": "USAJOBS Position Detail", "description": "Get full detail for a specific federal job posting by control number (PositionID) \u2014 full description, qualifications, duties, benefits summary, application instructions, security clearance level, telework eligibility.", "inputSchema": { "type": "object", "properties": { "control_number": { "type": "string", "description": "PositionID from a search result (digits-only string, e.g. \"856924100\"). Found in the MatchedObjectId field." } }, "required": [ "control_number" ], "description": "Fetch full detail for a specific federal job posting by control number." }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "usajobs.jobs.search", "title": "USAJOBS Federal Job Search", "description": "Search US federal civil-service job postings \u2014 by keyword, location, pay grade (GS-1 to GS-15, SES), agency, position type. Returns position title, agency, location, salary range, grade, open period, application URL. USAJOBS is the ONLY source for US federal civil-service postings, distinct from BLS, ESCO, CareerJet, Adzuna, Reed, Jooble, Arbeitnow, Remotive, and TheirStack.", "inputSchema": { "type": "object", "properties": { "keyword": { "type": "string", "description": "Free-text search across job title + description. Examples: 'software engineer', 'cybersecurity analyst', 'data scientist'." }, "location_name": { "type": "string", "description": "Location filter. City + state, ZIP, or state name. Examples: 'Washington, DC', 'San Francisco, CA', '94102'." }, "pay_grade_low": { "type": "string", "description": "Minimum federal pay grade. Format: 'GS01'-'GS15', 'SES', or 'EX-V'. Default: any." }, "pay_grade_high": { "type": "string", "description": "Maximum federal pay grade (same format as pay_grade_low)." }, "organization": { "type": "string", "description": "Agency code or name fragment. Examples: 'DOD' (Defense), 'VA' (Veterans Affairs), 'HHS' (Health and Human Services)." }, "position_title": { "type": "string", "description": "Strict position-title filter. Use keyword for fuzzy match." }, "results_per_page": { "type": "integer", "minimum": 1, "maximum": 500, "description": "Results per page (1-500, default 25).", "default": 25 }, "page": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Page number for pagination (default 1).", "default": 1 } }, "description": "Search US federal civil-service job postings by keyword, location, pay grade, agency, or position title." }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "nrel.afdc.detail", "title": "NREL AFDC Station Detail", "description": "Get detailed record for one specific alt-fuel station by its AFDC station ID \u2014 operator info, full address, hours per day-of-week, EV charging speed breakdown (Level 1/2/DC Fast outlet counts), accepted payment methods, access restrictions.", "inputSchema": { "type": "object", "properties": { "station_id": { "type": "integer", "description": "AFDC station ID (positive integer). Obtained from afdc_stations_nearest or afdc_stations_search results.", "minimum": 0 } }, "required": [ "station_id" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "nrel.afdc.nearest", "title": "NREL AFDC Nearest Alt-Fuel Stations", "description": "Find the nearest alternative fuel stations to a given US location (latitude/longitude). Includes EV charging (Level 1/2/DC Fast), CNG, LNG, propane, biodiesel, hydrogen. Returns station name, address, network, plug types, hours, last verified date. US-specific; for global EV stations use openchargemap.", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "WGS84 latitude (US territory only). Example: 37.7749 for San Francisco." }, "longitude": { "type": "number", "description": "WGS84 longitude (US territory only). Example: -122.4194 for San Francisco." }, "fuel_type": { "type": "string", "description": "Comma-separated fuel codes: ELEC (electric), CNG, LNG, LPG (propane), BD (biodiesel), E85, HY (hydrogen). Default ELEC.", "default": "ELEC" }, "status": { "type": "string", "enum": [ "E", "P", "T" ], "description": "Station status: E=available (open), P=planned (future), T=temporarily unavailable. Default E.", "default": "E" }, "radius": { "type": "number", "description": "Search radius in miles (max 500). Default 5.", "default": 5 }, "limit": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Max stations to return (1-200). Default 20.", "default": 20 } }, "required": [ "latitude", "longitude" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "nrel.afdc.search", "title": "NREL AFDC Alt-Fuel Stations Search", "description": "Search US alt-fuel stations by ZIP, state, or city. Filterable by fuel type, EV network, connector type, and access level. Use for state-level analytics or city-wide EV infrastructure surveys; use afdc_stations_nearest for proximity search to a coordinate.", "inputSchema": { "type": "object", "properties": { "zip": { "type": "string", "description": "5-digit US ZIP code to search within. Example: '94102'." }, "state": { "type": "string", "description": "2-letter US state code. Example: 'CA', 'TX', 'NY'." }, "city": { "type": "string", "description": "City name. Use with state for disambiguation. Example: Oakland." }, "fuel_type": { "type": "string", "description": "Comma-separated fuel codes: ELEC (electric), CNG, LNG, LPG (propane), BD (biodiesel), E85, HY (hydrogen). Default ELEC.", "default": "ELEC" }, "ev_connector_type": { "type": "string", "description": "EV connector codes (comma-separated): J1772 (Level 2), J1772COMBO (CCS), CHADEMO, TESLA, NEMA1450, NEMA515." }, "access": { "type": "string", "enum": [ "public", "private" ], "description": "Filter by access type: 'public' for open-access stations, 'private' for fleet-only." }, "status": { "type": "string", "enum": [ "E", "P", "T" ], "description": "Station status: E=available (open), P=planned (future), T=temporarily unavailable. Default E.", "default": "E" }, "limit": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Results per page (1-200). Default 50.", "default": 50 }, "offset": { "type": "integer", "minimum": 0, "description": "Pagination offset \u2014 number of results to skip. Default 0.", "default": 0 } } }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "nrel.pvwatts.estimate", "title": "NREL PVWatts Solar PV Production Estimate", "description": "Calculate monthly and annual AC energy production (kWh) for a residential or commercial solar PV system at any global location. Uses NSRDB satellite-derived solar resource data. Returns monthly AC/DC energy, capacity factor, plane-of-array irradiance, and solar radiation. Unique \u2014 no other tool in this catalog estimates solar PV output.", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "Site latitude in decimal degrees (global, WGS84). Example: 37.7749 (San Francisco), 51.5074 (London)." }, "longitude": { "type": "number", "description": "Site longitude in decimal degrees (global, WGS84). Example: -122.4194 (San Francisco), -0.1278 (London)." }, "system_capacity": { "type": "number", "description": "System DC nameplate capacity in kilowatts (kW). Example: 5 for a typical residential system, 100 for commercial.", "minimum": 0 }, "module_type": { "type": "integer", "minimum": 0, "maximum": 2, "description": "Solar module type: 0=Standard (polycrystalline), 1=Premium (monocrystalline, default), 2=Thin Film.", "default": 1 }, "losses": { "type": "number", "minimum": 0, "maximum": 99, "description": "System losses percentage (0-99). Accounts for wiring, soiling, shading. Default 14 (NREL recommended).", "default": 14 }, "array_type": { "type": "integer", "minimum": 0, "maximum": 4, "description": "Array mount type: 0=Fixed open rack, 1=Fixed roof mount (default), 2=1-axis tracking, 3=1-axis backtracking, 4=2-axis tracking.", "default": 1 }, "tilt": { "type": "number", "minimum": 0, "maximum": 90, "description": "Module tilt angle in degrees from horizontal (0=flat/horizontal, 90=vertical). Default 20.", "default": 20 }, "azimuth": { "type": "number", "minimum": 0, "maximum": 360, "description": "Array azimuth angle: 0=north, 90=east, 180=south (default, optimal in Northern Hemisphere), 270=west.", "default": 180 } }, "required": [ "latitude", "longitude", "system_capacity" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "opendota.matches.detail", "title": "OpenDota Match Detail", "description": "Full detail of one Dota 2 match \u2014 all 10 players with hero, items, K/D/A, gold/XP per minute, ability picks, team composition, game duration, winner. Heavy parse but rich data.", "inputSchema": { "type": "object", "properties": { "match_id": { "type": "integer", "description": "Dota 2 match ID (64-bit integer from player_matches)." } }, "required": [ "match_id" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "opendota.players.matches", "title": "OpenDota Player Match History", "description": "Recent match history for a Dota 2 player \u2014 array of matches with match_id, hero, kills/deaths/assists, duration, win/loss, party_size, game_mode, lobby_type. Sortable by date.", "inputSchema": { "type": "object", "properties": { "account_id": { "type": "integer", "description": "Steam account ID (Dota 2 32-bit). Get from /api/search?q=playername. Example: 105248644 (Dendi)." }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max matches to return (1-100, default 20).", "default": 20 } }, "required": [ "account_id" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "opendota.players.summary", "title": "OpenDota Player Summary", "description": "Get a Dota 2 player's profile + summary stats by Steam Account ID \u2014 name, avatar, MMR estimate, total wins/losses, rank tier, last match time. Profile may be private (returns minimal info).", "inputSchema": { "type": "object", "properties": { "account_id": { "type": "integer", "description": "Steam account ID (Dota 2 32-bit). Get from /api/search?q=playername. Example: 105248644 (Dendi)." } }, "required": [ "account_id" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "opendota.proteams.list", "title": "OpenDota Pro Teams", "description": "List professional Dota 2 teams with rating, wins/losses, last match time, logo URL, team_id, sponsor. Sorted by rating descending.", "inputSchema": { "type": "object", "properties": { "_unused": { "type": "string", "description": "Reserved for future filtering \u2014 not currently used." } } }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "checkwx.metar.decoded", "title": "CheckWX Decoded METAR", "description": "Get current METAR for one or more airports as fully decoded JSON \u2014 wind (direction/speed/gust as separate fields), visibility (in SM and meters), sky conditions (cloud coverage + altitude as objects), temperature/dewpoint (\u00b0C and \u00b0F), altimeter (inHg and hPa), flight category (VFR/MVFR/IFR/LIFR). Saves agents from parsing raw METAR text.", "inputSchema": { "type": "object", "properties": { "icao_codes": { "type": "string", "description": "Comma-separated ICAO airport codes (uppercase 4 letters). Max 25 per call. Examples: 'KJFK,EGLL,RJTT', 'KSFO', 'EDDF'." } }, "required": [ "icao_codes" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "checkwx.stations.info", "title": "CheckWX Station Information", "description": "Airport/weather-station metadata by ICAO \u2014 name, IATA, latitude/longitude/elevation, country, city, time zone, runway info (count, longest length, surface).", "inputSchema": { "type": "object", "properties": { "icao_code": { "type": "string", "description": "Single ICAO airport/station code (4-letter uppercase). Examples: 'KJFK', 'EGLL', 'RJTT'." } }, "required": [ "icao_code" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "checkwx.taf.decoded", "title": "CheckWX Decoded TAF", "description": "Decoded TAF forecast for airports \u2014 issued time, valid window, per-period forecast objects (wind, visibility, weather conditions, sky). Each forecast change block parsed into structured JSON.", "inputSchema": { "type": "object", "properties": { "icao_codes": { "type": "string", "description": "Comma-separated ICAO airport codes (uppercase 4 letters). Max 25 per call. Examples: 'KJFK,EGLL,RJTT', 'KSFO', 'EDDF'." } }, "required": [ "icao_codes" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "avwx.notams.list", "title": "AVWX Parsed NOTAMs", "description": "Active NOTAMs (Notice to Airmen) for one or more airports, parsed into structured fields \u2014 NOTAM ID, classification (FDC/D/U), type (runway closure, navaid out, airspace restriction, obstacle), effective period, summary text. Critical for flight planning. UNIQUE to AVWX \u2014 NOAA and CheckWX do NOT return parsed NOTAMs.", "inputSchema": { "type": "object", "properties": { "icao_code": { "type": "string", "description": "Single ICAO airport code (4-letter uppercase). Examples: KJFK, EGLL, RJTT, OMDB." }, "distance": { "type": "integer", "minimum": 0, "maximum": 100, "description": "Include NOTAMs within this nautical-mile radius (0-100, default 10). Use 0 for airport-specific only." } }, "required": [ "icao_code" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "avwx.pireps.list", "title": "AVWX Parsed PIREPs", "description": "Pilot Reports (PIREPs) near an airport, parsed \u2014 aircraft type, altitude, time, location, sky condition observed, turbulence, icing, weather. Source: pilots reporting in-flight conditions. Useful for hazard awareness.", "inputSchema": { "type": "object", "properties": { "icao_code": { "type": "string", "description": "Single ICAO airport code (4-letter uppercase). Examples: KJFK, EGLL, KSFO." } }, "required": [ "icao_code" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "avwx.stations.summary", "title": "AVWX Station Summary", "description": "Composite report for one airport \u2014 latest parsed METAR + TAF + station info (name, lat/lon/elev, type) in one call. Cheaper than three separate calls if you need the full picture.", "inputSchema": { "type": "object", "properties": { "icao_code": { "type": "string", "description": "Single ICAO airport code (4-letter uppercase). Examples: KJFK, EGLL, KSFO." } }, "required": [ "icao_code" ] }, "outputSchema": { "type": "object", "properties": { "result": { "type": [ "object", "array", "string", "number", "boolean", "null" ], "description": "Tool response payload. Shape varies per tool \u2014 consult the tool description and inputSchema." }, "error": { "type": "object", "description": "Present only when the call failed. Includes error code, message, request_id." } }, "required": [ "result" ], "additionalProperties": false }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } } ], "prompts": [ { "name": "discover-tools", "description": "Find the right APIbase tools for a task. Describes available categories, search strategies, and tool selection criteria.", "arguments": [ { "name": "task", "description": "What you want to accomplish (e.g. \"find flights from NYC to London\")", "required": true } ] }, { "name": "api-workflow", "description": "Design a multi-step API workflow combining multiple APIbase tools. Returns execution plan with tool sequence, data flow, and error handling.", "arguments": [ { "name": "goal", "description": "End-to-end goal (e.g. \"plan a trip to Tokyo with flights, weather, and local events\")", "required": true }, { "name": "budget", "description": "Optional USDC budget constraint for the workflow", "required": false } ] }, { "name": "x402-payment-guide", "description": "Explains x402 USDC micropayment flow for APIbase. Covers wallet setup on Base, payment headers, escrow mechanics, and refund policy.", "arguments": [ { "name": "topic", "description": "Specific payment topic (e.g. \"setup\", \"escrow\", \"refunds\", \"pricing\")", "required": false } ] } ], "resources": [ { "name": "tool-catalog", "description": "Full tool catalog with schemas, pricing, and provider info", "uri": "https://apibase.pro/api/v1/tools" }, { "name": "health-status", "description": "System health check", "uri": "https://apibase.pro/health/ready" } ] }