Content here
\")", "minLength": 1 }, "fileName": { "type": "string", "description": "Output filename (e.g. \"report.pdf\")" }, "options": { "type": "object", "properties": { "landscape": { "type": "boolean", "description": "Landscape orientation (default false)" }, "printBackground": { "type": "boolean", "description": "Render background colors and images (default true)" }, "displayHeaderFooter": { "type": "boolean", "description": "Show header/footer (default false)" }, "headerTemplate": { "type": "string", "description": "HTML template for page header" }, "footerTemplate": { "type": "string", "description": "HTML template for page footer" }, "paperWidth": { "type": "number", "description": "Page width in inches (default 8.27 for A4)" }, "paperHeight": { "type": "number", "description": "Page height in inches (default 11.69 for A4)" }, "marginTop": { "type": "number", "description": "Top margin in inches (default 0.4)" }, "marginBottom": { "type": "number", "description": "Bottom margin in inches (default 0.4)" } }, "description": "PDF rendering options (page size, margins, header/footer)" } }, "required": [ "html" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "document.pdf.from_url", "description": "Capture any web page URL as a PDF using headless Chrome with full JS rendering \u2014 perfect for archiving pages, generating reports from dashboards, or creating printable snapshots. Returns temporary PDF download URL (API2PDF)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to capture as PDF (e.g. \"https://example.com/report\")" }, "fileName": { "type": "string", "description": "Output filename (e.g. \"snapshot.pdf\")" }, "options": { "type": "object", "properties": { "landscape": { "type": "boolean", "description": "Landscape orientation (default false)" }, "printBackground": { "type": "boolean", "description": "Render background colors (default true)" }, "paperWidth": { "type": "number", "description": "Page width in inches" }, "paperHeight": { "type": "number", "description": "Page height in inches" } }, "description": "PDF rendering options" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "document.pdf.merge", "description": "Merge 2-20 PDF documents (provided as URLs) into a single combined PDF. Preserves page order. Returns temporary download URL for the merged result (API2PDF)", "inputSchema": { "type": "object", "properties": { "urls": { "type": "array", "items": { "type": "string" }, "description": "Ordered list of PDF URLs to merge (2-20 URLs)", "minItems": 2, "maxItems": 20 }, "fileName": { "type": "string", "description": "Output filename for merged PDF (e.g. \"combined.pdf\")" } }, "required": [ "urls" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "media.podcast.search", "description": "Search 4M+ podcasts by keyword \u2014 returns title, author, description, artwork, episode count, language, categories, RSS feed URL. Open directory covering all languages and countries (PodcastIndex)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search term or phrase (e.g. \"artificial intelligence\", \"Lex Fridman\", \"true crime\")", "minLength": 2 }, "max": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max results to return (default 20, max 100)" }, "lang": { "type": "string", "description": "Filter by language code (e.g. \"en\", \"de\", \"es\", \"ja\")" }, "cat": { "type": "string", "description": "Filter by category name (e.g. \"Technology\", \"News\", \"Comedy\", \"Business\")" } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "media.podcast.trending", "description": "Currently trending podcasts globally \u2014 ranked by recent episode engagement. Filter by language and category. Returns title, author, artwork, trending score, episode count (PodcastIndex)", "inputSchema": { "type": "object", "properties": { "max": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of trending podcasts (default 20, max 100)" }, "lang": { "type": "string", "description": "Filter by language code (e.g. \"en\")" }, "cat": { "type": "string", "description": "Filter by category (e.g. \"Technology\", \"News\")" }, "since": { "type": "integer", "description": "Unix timestamp \u2014 only include podcasts with new episodes since this time" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "media.podcast.episodes", "description": "List recent episodes for a podcast by feed ID \u2014 title, description, publish date, audio URL, duration, season/episode numbers. Use feed ID from search or trending results (PodcastIndex)", "inputSchema": { "type": "object", "properties": { "id": { "type": "integer", "description": "PodcastIndex feed ID (from search or trending results)" }, "max": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of episodes to return (default 20, max 100)" }, "since": { "type": "integer", "description": "Unix timestamp \u2014 only return episodes published after this time" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "media.podcast.details", "description": "Full metadata for a single podcast \u2014 title, author, description, RSS URL, artwork, language, categories, episode count, last update time, funding links (PodcastIndex)", "inputSchema": { "type": "object", "properties": { "id": { "type": "integer", "description": "PodcastIndex feed ID to retrieve full metadata for" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "address.geocodio.geocode", "description": "Forward geocode a US or Canada address to coordinates \u2014 returns lat/lng, parsed address components (street, city, state, ZIP, county), accuracy type (rooftop/range/street), and data source. USPS-standardized results with Census data (Geocodio)", "inputSchema": { "type": "object", "properties": { "address": { "type": "string", "description": "US or Canada address to geocode (e.g. \"1600 Pennsylvania Ave NW, Washington DC\", \"350 5th Ave, New York, NY 10118\")", "minLength": 3 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results to return (default 5, max 20)" } }, "required": [ "address" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "address.geocodio.reverse", "description": "Reverse geocode latitude/longitude to a US or Canada address \u2014 returns formatted address, parsed components (street, city, state, ZIP, county), accuracy type, and source. Supports multiple results ranked by proximity (Geocodio)", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude (24-72 range for US/Canada, e.g. 38.8976)", "minimum": 24, "maximum": 72 }, "lon": { "type": "number", "description": "Longitude (negative for Western Hemisphere, e.g. -77.0365)", "minimum": -180, "maximum": -50 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results to return (default 5, max 20)" } }, "required": [ "lat", "lon" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "business.hunter.company", "description": "Find professional email addresses and company data for any domain \u2014 organization name, industry, employee count, tech stack, social profiles, email pattern, and verified contact emails with confidence scores, positions, departments, seniority levels. 50M+ domains indexed (Hunter.io)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Company domain name (e.g. \"stripe.com\", \"google.com\", \"microsoft.com\")", "minLength": 3 }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max number of emails to return (default 10, max 100)" }, "department": { "type": "string", "enum": [ "executive", "finance", "hr", "it", "marketing", "operations", "sales", "legal", "management", "communication" ], "description": "Filter by department (e.g. \"engineering\", \"sales\", \"marketing\")" }, "type": { "type": "string", "enum": [ "personal", "generic" ], "description": "Filter by email type: \"personal\" (name@domain) or \"generic\" (info@domain)" } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "fdic.institutions.search", "description": "Search 4,300+ FDIC-insured US financial institutions by name, city, state, or charter type. Returns bank name, FDIC certificate number, total assets, deposits, and location. Official US Government data.", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Partial or full institution name to search (e.g. \"Chase\", \"Wells Fargo\")" }, "city": { "type": "string", "description": "City name filter (e.g. \"New York\", \"San Francisco\")" }, "state": { "type": "string", "description": "US state name filter (e.g. \"California\", \"New York\")" }, "charter_class": { "type": "string", "enum": [ "N", "SM", "NM", "SB", "OI" ], "description": "Charter type: N=national, SM=state member, NM=state nonmember, SB=savings bank, OI=OCC-supervised" }, "active": { "type": "boolean", "description": "Filter by active status. Default true (only active institutions)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results to return, max 50 (default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "fdic.institutions.details", "description": "Get full regulatory profile for an FDIC-insured bank by certificate number. Returns address, charter class, regulator, assets, deposits, branches, established date, insurance date, and coordinates.", "inputSchema": { "type": "object", "properties": { "cert": { "type": "integer", "description": "FDIC certificate number uniquely identifying the institution (obtain via fdic.search)" } }, "required": [ "cert" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "fdic.institutions.financials", "description": "Retrieve quarterly Call Report financial data for an FDIC-insured institution. Returns total assets, deposits, equity, net income, ROA, ROE, net interest margin, and efficiency ratio.", "inputSchema": { "type": "object", "properties": { "cert": { "type": "integer", "description": "FDIC certificate number for the institution" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of quarterly periods to return, max 20 (default 4)" } }, "required": [ "cert" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "fdic.institutions.failures", "description": "Query the FDIC failed bank list. Returns 4,100+ historical bank failures with failure date, assets at closure, acquiring institution, and estimated loss to the Deposit Insurance Fund. Covers all failures since 1934.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "Two-letter US state code filter (e.g. \"CA\", \"NY\", \"TX\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results to return, max 50 (default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "disease.covid.global", "description": "Get aggregated global COVID-19 statistics: total cases (704M+), deaths, recoveries, active cases, critical cases, cases/deaths per million, tests administered, and affected countries count. Data from Worldometers and OWID.", "inputSchema": { "type": "object", "properties": { "yesterday": { "type": "boolean", "description": "Return yesterday's data instead of today's (default false)" }, "twoDaysAgo": { "type": "boolean", "description": "Return data from two days ago for comparison (default false)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "disease.covid.country", "description": "Get COVID-19 statistics for a specific country by name or ISO code. Returns cases, deaths, recoveries, active, critical, per-million rates, tests, population, and flag. Covers 215+ countries and territories.", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Country name, ISO2 code, or ISO3 code (e.g. \"United States\", \"US\", \"USA\", \"Germany\", \"DE\")" }, "yesterday": { "type": "boolean", "description": "Return yesterday's data instead of today's (default false)" }, "strict": { "type": "boolean", "description": "Use strict name matching instead of fuzzy search (default false)" } }, "required": [ "country" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "disease.covid.history", "description": "Get historical time-series COVID-19 data for a country or globally. Returns daily case, death, and recovery counts. Useful for trend analysis and longitudinal research. Data from Johns Hopkins CSSE.", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Country name, ISO2/ISO3 code, or \"all\" for global aggregate (default \"all\")" }, "lastdays": { "type": "integer", "minimum": 1, "maximum": 1500, "description": "Number of most recent days to return (default 30, max ~1500 for full history)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "disease.influenza.cdc", "description": "Get US influenza surveillance data from CDC FluView. Returns weekly ILI (influenza-like illness) activity levels by age group, positive test rates by influenza type (A/B), and national summary. Updated weekly.", "inputSchema": { "type": "object", "properties": { "source": { "type": "string", "enum": [ "ilinet", "usil" ], "description": "Data source: \"ilinet\" for ILI network data or \"usil\" for US ILI summary (default \"ilinet\")" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "who.health.indicators", "description": "List 1,000+ WHO Global Health Observatory indicators: life expectancy, mortality rates, disease burden, immunization, nutrition, mental health, environmental health. Returns indicator codes for use with who.data.", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Keyword to filter indicators by name (e.g. \"mortality\", \"immunization\", \"life expectancy\", \"HIV\", \"malaria\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of indicators to return, max 100 (default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "who.health.data", "description": "Retrieve WHO health data for a specific indicator, optionally filtered by country and year range. Returns values for up to 194 countries spanning multiple decades. Official UN member state reporting data.", "inputSchema": { "type": "object", "properties": { "indicator": { "type": "string", "description": "WHO indicator code (e.g. \"WHOSIS_000001\" for life expectancy, \"MDG_0000000001\" for under-5 mortality). Get codes from who.indicators" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-3 country code (e.g. \"USA\", \"DEU\", \"BRA\", \"JPN\"). Omit for all countries" }, "year_from": { "type": "integer", "description": "Earliest year to include (e.g. 2000)" }, "year_to": { "type": "integer", "description": "Latest year to include (e.g. 2023)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of data points to return, max 100 (default 20)" } }, "required": [ "indicator" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "who.health.countries", "description": "List all 194 WHO member countries and territories with codes and names. Use returned country codes with who.data to filter health indicators by country.", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Partial country name to filter (e.g. \"United\", \"Germany\", \"Brazil\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Number of countries to return, max 200 (default 50)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "gdacs.disasters.alerts", "description": "Get current and recent global disaster alerts from the UN GDACS system. Returns earthquakes, tropical cyclones, floods, volcanoes, droughts, and tsunamis with color-coded severity (Green/Orange/Red), affected country, coordinates, and population impact estimates.", "inputSchema": { "type": "object", "properties": { "event_type": { "type": "string", "enum": [ "EQ", "TC", "FL", "VO", "DR", "TS" ], "description": "Filter by disaster type: EQ=earthquake, TC=tropical cyclone, FL=flood, VO=volcano, DR=drought, TS=tsunami" }, "alert_level": { "type": "string", "enum": [ "Green", "Orange", "Red" ], "description": "Minimum alert level filter: Green (low), Orange (medium), Red (high impact)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of events to return, max 50 (default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "gdacs.disasters.details", "description": "Get detailed information for a specific GDACS disaster event by ID. Returns event name, alert level with justification, affected population at each severity level, coordinates, geometry for mapping, source agency, and situation report links.", "inputSchema": { "type": "object", "properties": { "event_id": { "type": "integer", "description": "GDACS event ID (obtain via gdacs.alerts)" }, "event_type": { "type": "string", "enum": [ "EQ", "TC", "FL", "VO", "DR", "TS" ], "description": "Event type code: EQ=earthquake, TC=tropical cyclone, FL=flood, VO=volcano, DR=drought, TS=tsunami" } }, "required": [ "event_id", "event_type" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "gdacs.disasters.history", "description": "Query the GDACS historical disaster archive from 2000 onwards. Filter by date range, event type, country, and alert level. Returns past earthquakes, cyclones, floods, and volcanoes for disaster frequency analysis and regional risk assessment.", "inputSchema": { "type": "object", "properties": { "date_from": { "type": "string", "description": "Start date in YYYY-MM-DD format (e.g. \"2024-01-01\")" }, "date_to": { "type": "string", "description": "End date in YYYY-MM-DD format (e.g. \"2024-12-31\")" }, "event_type": { "type": "string", "enum": [ "EQ", "TC", "FL", "VO", "DR", "TS" ], "description": "Filter by disaster type" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-3 country code (e.g. \"JPN\", \"PHL\", \"USA\", \"IDN\")" }, "alert_level": { "type": "string", "enum": [ "Green", "Orange", "Red" ], "description": "Minimum alert level filter" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of events to return, max 50 (default 10)" } }, "required": [ "date_from", "date_to" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "rateapi.lending.mortgage", "description": "Get AI-powered mortgage rate decision from 4,300+ US lenders. Returns recommended actions, current APR rates, estimated monthly payments, and confidence scores. Supports 30yr/15yr fixed and ARM products. Filter by state, amount, and credit tier.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Two-letter US state code (e.g. \"CA\", \"NY\", \"TX\")" }, "amount": { "type": "number", "minimum": 10000, "description": "Loan amount in USD (e.g. 400000 for a $400K mortgage)" }, "term_months": { "type": "integer", "description": "Loan term in months: 180 (15yr), 360 (30yr), or custom" }, "rate_type": { "type": "string", "enum": [ "fixed", "adjustable" ], "description": "Rate type: \"fixed\" or \"adjustable\" (ARM)" }, "intent": { "type": "string", "enum": [ "purchase", "refinance" ], "description": "Loan intent: \"purchase\" for buying or \"refinance\"" }, "credit_score": { "type": "string", "enum": [ "excellent", "good", "fair", "poor" ], "description": "Credit score tier for rate filtering" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "rateapi.lending.auto", "description": "Get auto loan rate decision for new and used vehicles from US lenders. Returns recommended financing actions, APR rates by term (24-72 months), and estimated monthly payments. Filter by vehicle type and credit tier.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Two-letter US state code" }, "amount": { "type": "number", "minimum": 1000, "description": "Loan amount in USD (e.g. 35000)" }, "term_months": { "type": "string", "enum": [ "24", "36", "48", "60", "72" ], "description": "Loan term: 24, 36, 48, 60, or 72 months" }, "vehicle_type": { "type": "string", "enum": [ "new", "used" ], "description": "Vehicle type: \"new\" or \"used\"" }, "credit_score": { "type": "string", "enum": [ "excellent", "good", "fair", "poor" ], "description": "Credit score tier" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "rateapi.lending.heloc", "description": "Get Home Equity Line of Credit (HELOC) rate decision. Returns current HELOC APR rates, recommended actions, and lender comparisons. Filter by combined loan-to-value ratio (CLTV), state, and credit score tier.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "Two-letter US state code" }, "cltv": { "type": "number", "minimum": 0, "maximum": 95, "description": "Combined loan-to-value ratio (0-95)" }, "credit_score": { "type": "string", "enum": [ "excellent", "good", "fair", "poor" ], "description": "Credit score tier" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "rateapi.lending.personal", "description": "Get personal loan rate decision from US lenders. Returns recommended financing actions, APR rates by term and amount, and monthly payment estimates. Filter by loan amount, term, and credit score tier.", "inputSchema": { "type": "object", "properties": { "amount": { "type": "number", "minimum": 1000, "description": "Loan amount in USD (e.g. 10000)" }, "term_months": { "type": "string", "enum": [ "12", "24", "36", "48", "60" ], "description": "Loan term: 12, 24, 36, 48, or 60 months" }, "credit_score": { "type": "string", "enum": [ "excellent", "good", "fair", "poor" ], "description": "Credit score tier" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "twitter.tweets.search", "description": "Search Twitter/X tweets by keyword, hashtag, or advanced query. Returns tweet text, author info, engagement metrics (likes, retweets, replies, views), and timestamps. 96% cheaper than official X API. Covers recent tweets.", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query \u2014 keywords, hashtags, or advanced operators (e.g. \"AI agents\", \"#crypto\", \"from:elonmusk\")" }, "sort_order": { "type": "string", "enum": [ "recency", "relevancy" ], "description": "Sort order: \"recency\" for latest first, \"relevancy\" for most relevant (default recency)" }, "cursor": { "type": "string", "description": "Pagination cursor from previous response (for next page of results)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "twitter.users.profile", "description": "Get a Twitter/X user profile by username. Returns display name, bio, follower/following count, tweet count, verified status, profile image, location, and account creation date.", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "Twitter/X username without @ (e.g. \"elonmusk\", \"OpenAI\")" }, "user_id": { "type": "string", "description": "Twitter/X numeric user ID as alternative to username" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "twitter.users.followers", "description": "Get paginated follower list for a Twitter/X user. Returns follower profiles with username, display name, bio, follower count, and verified status. Supports cursor pagination.", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "Twitter/X username to get followers for (without @)" }, "cursor": { "type": "string", "description": "Pagination cursor from previous response" } }, "required": [ "username" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "twitter.trends.worldwide", "description": "Get current trending topics on Twitter/X. Filter by location using WOEID (Where On Earth ID). Returns trend name, search query, and rank. 1=worldwide, 23424977=US, 23424975=UK.", "inputSchema": { "type": "object", "properties": { "woeid": { "type": "integer", "description": "Where On Earth ID for location-specific trends (1=worldwide, 23424977=US, 23424975=UK, 23424856=Japan)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "currents.news.latest", "description": "Get latest breaking news from 70+ countries in 18+ languages. Returns full article text, author, source URL, and publication time. Filter by language, country, and category (technology, business, health, sports, science, finance, world).", "inputSchema": { "type": "object", "properties": { "language": { "type": "string", "description": "ISO 639-1 language code (e.g. \"en\", \"de\", \"fr\", \"ja\", \"zh\"). Default: all languages" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"US\", \"GB\", \"DE\", \"JP\")" }, "category": { "type": "string", "description": "News category filter (e.g. \"technology\", \"business\", \"health\", \"sports\", \"science\", \"entertainment\", \"finance\", \"world\")" }, "page_size": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Number of articles to return, max 200 (default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "currents.news.search", "description": "Search news articles by keyword across 70+ countries and 18+ languages. Returns full article text with Boolean operator support. Filter by language, country, category, and date range.", "inputSchema": { "type": "object", "properties": { "keywords": { "type": "string", "description": "Search keywords \u2014 supports Boolean operators (e.g. \"AI agents\", \"climate AND policy\")" }, "language": { "type": "string", "description": "ISO 639-1 language code (e.g. \"en\", \"es\", \"ar\")" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-2 country code" }, "start_date": { "type": "string", "description": "Start date in ISO 8601 format (e.g. \"2026-03-01T00:00:00+00:00\")" }, "end_date": { "type": "string", "description": "End date in ISO 8601 format" }, "page_size": { "type": "integer", "minimum": 1, "maximum": 200, "description": "Number of articles to return, max 200 (default 10)" } }, "required": [ "keywords" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "currents.news.categories", "description": "List all 46 available news categories: technology, business, health, sports, science, entertainment, finance, world, politics, and more. Use to discover valid category values for filtering.", "inputSchema": { "type": "object", "properties": { "locale": { "type": "string", "description": "Response locale (default: en)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "iban.banking.validate", "description": "Validate an IBAN and retrieve associated bank info: BIC/SWIFT code, bank name, address, country, currency, and SEPA membership. Supports 80+ IBAN-enabled countries including EU, UK, and MENA. Returns validation result with detailed breakdown.", "inputSchema": { "type": "object", "properties": { "iban": { "type": "string", "description": "IBAN to validate (e.g. \"DE89370400440532013000\", \"GB29NWBK60161331926819\"). Spaces allowed, auto-stripped." } }, "required": [ "iban" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "iban.banking.calculate", "description": "Calculate a valid IBAN from domestic bank routing details: country code, bank code, account number, and optional branch code. Returns the computed IBAN with correct checksum. Useful for payment automation.", "inputSchema": { "type": "object", "properties": { "country_code": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"DE\", \"GB\", \"FR\", \"NL\")", "minLength": 2, "maxLength": 2 }, "bank_code": { "type": "string", "description": "Domestic bank code (e.g. \"37040044\" for Germany, \"NWBK\" for UK)" }, "account_number": { "type": "string", "description": "Account number in domestic format" }, "branch_code": { "type": "string", "description": "Branch/sort code if required by the country (e.g. \"601613\" for UK)" } }, "required": [ "country_code", "bank_code", "account_number" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chemistry.pubchem.search", "description": "Search 100M+ chemical compounds by name, formula, or SMILES string. Returns CID, molecular formula, weight, IUPAC name, SMILES, InChI, XLogP, H-bond donors/acceptors, exact mass, and complexity. The largest public chemical database (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Compound name, formula, or SMILES string (e.g. \"aspirin\", \"C9H8O4\", \"CC(=O)OC1=CC=CC=C1C(=O)O\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Maximum results to return (1-20, default 5)" } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chemistry.pubchem.properties", "description": "Get full physical and chemical properties for a compound by PubChem CID \u2014 molecular formula, weight, SMILES, InChI, InChIKey, XLogP, H-bond donors/acceptors, exact mass, topological polar surface area, complexity, charge, heavy atom count (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "cid": { "type": "integer", "description": "PubChem Compound ID (CID) \u2014 get from compound_search results" } }, "required": [ "cid" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chemistry.pubchem.synonyms", "description": "Get all known names, CAS registry numbers, trade names, and identifiers for a chemical compound by PubChem CID. Returns up to 50 synonyms from a database of millions of name variants (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "cid": { "type": "integer", "description": "PubChem Compound ID (CID) \u2014 returns all known names, CAS numbers, trade names" } }, "required": [ "cid" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chemistry.pubchem.hazards", "description": "Get GHS (Globally Harmonized System) hazard classification for a compound \u2014 signal words (Danger/Warning), hazard statements (H-codes), precautionary statements (P-codes), pictograms. Essential for chemical safety assessments (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "cid": { "type": "integer", "description": "PubChem Compound ID (CID) \u2014 returns GHS hazard classification, pictograms, signal words" } }, "required": [ "cid" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chemistry.pubchem.bioassays", "description": "Get bioactivity assay results for a compound \u2014 active/inactive counts, tested targets, assay types. Shows how the compound performed in biological tests across thousands of assays (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "cid": { "type": "integer", "description": "PubChem Compound ID (CID) \u2014 returns bioactivity assay results (active/inactive counts, targets)" } }, "required": [ "cid" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chemistry.pubchem.structure", "description": "Look up a compound by name or identifier and get its chemical structure representations \u2014 SMILES (isomeric + canonical), InChI, InChIKey, molecular formula, and molecular weight. Convert between chemical identifier formats (PubChem / NCBI)", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Compound name or identifier (e.g. \"caffeine\", \"50-78-2\") \u2014 returns SMILES, InChI, InChIKey, formula" } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ev.charging.search", "description": "Search 300K+ EV charging stations worldwide by location, country, operator, connector type, and power level. Returns station address, GPS coordinates, connectors (Type 2, CCS, CHAdeMO), power kW, operator, status. Filter by min power for fast charging. Largest open EV charging database (Open Charge Map)", "inputSchema": { "type": "object", "properties": { "country_code": { "type": "string", "description": "ISO 2-letter country code to filter by (e.g. \"US\", \"GB\", \"DE\")" }, "latitude": { "type": "number", "description": "Latitude for location-based search (e.g. 51.5074)" }, "longitude": { "type": "number", "description": "Longitude for location-based search (e.g. -0.1278)" }, "distance": { "type": "number", "description": "Search radius in distance_unit (default KM)" }, "distance_unit": { "type": "string", "enum": [ "KM", "Miles" ], "description": "Distance unit: KM or Miles (default KM)" }, "operator_id": { "type": "integer", "description": "Filter by charging network operator ID" }, "connection_type_id": { "type": "integer", "description": "Filter by connector type (e.g. 25=Type 2, 33=CCS, 2=CHAdeMO)" }, "min_power_kw": { "type": "number", "description": "Minimum charger power in kW (e.g. 50 for fast charging)" }, "status_type_id": { "type": "integer", "description": "Filter by status (50=Operational, 100=Not Operational)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Maximum results to return (1-100, default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ev.charging.details", "description": "Get full details for a specific EV charging station by ID \u2014 address, GPS coordinates, all connectors with type/power/status, network operator, usage cost, verification date, number of charging points. Use station ID from search or nearby results (Open Charge Map)", "inputSchema": { "type": "object", "properties": { "id": { "type": "integer", "description": "Open Charge Map station ID \u2014 get from search or nearby results" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ev.charging.nearby", "description": "Find the nearest EV charging stations to GPS coordinates within a radius (default 5km). Returns stations sorted by distance with connector types, power levels, and availability status. Filter by minimum power kW and connector type for DC fast charging (Open Charge Map)", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "GPS latitude of your location (e.g. 40.7128)" }, "longitude": { "type": "number", "description": "GPS longitude of your location (e.g. -74.0060)" }, "radius": { "type": "number", "description": "Search radius in KM (default 5)" }, "min_power_kw": { "type": "number", "description": "Minimum charger power in kW (e.g. 50 for DC fast charging)" }, "connection_type_id": { "type": "integer", "description": "Filter by connector type (25=Type 2, 33=CCS, 2=CHAdeMO)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Maximum results (1-50, default 10)" } }, "required": [ "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "security.ipqs.ip_check", "description": "Check any IP address for fraud signals \u2014 proxy, VPN, Tor, bot, crawler detection with fraud score (0-100). Returns geolocation (country, city, ISP, ASN), abuse velocity, connection type, and 9+ risk indicators. Essential for e-commerce fraud prevention (IPQualityScore)", "inputSchema": { "type": "object", "properties": { "ip": { "type": "string", "description": "IPv4 or IPv6 address to check (e.g. \"8.8.8.8\", \"2001:4860:4860::8888\")" }, "strictness": { "type": "integer", "minimum": 0, "maximum": 3, "description": "Detection strictness 0-3 (0=least strict, 3=most aggressive). Higher catches more fraud but may flag legitimate users" }, "allow_public_access_points": { "type": "boolean", "description": "Allow public WiFi/library IPs to pass without penalty (default false)" } }, "required": [ "ip" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "security.ipqs.email_check", "description": "Validate email for fraud risk \u2014 checks deliverability, disposable/temporary providers, honeypot traps, spam traps, leaked credentials, catch-all detection. Returns fraud score (0-100), SMTP verification, domain age, and abuse history. Goes beyond basic validation (IPQualityScore)", "inputSchema": { "type": "object", "properties": { "email": { "type": "string", "description": "Email address to validate and check for fraud (e.g. \"user@example.com\")" }, "fast": { "type": "boolean", "description": "Skip SMTP verification for faster response (default false)" }, "abuse_strictness": { "type": "integer", "minimum": 0, "maximum": 2, "description": "Abuse detection sensitivity 0-2 (0=low, 2=aggressive)" } }, "required": [ "email" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "security.ipqs.url_check", "description": "Scan any URL for malware, phishing, suspicious content, adult content, spamming, and domain parking. Returns risk score (0-100), domain reputation, domain age, IP address, HTTP status. Protects agents from visiting malicious URLs (IPQualityScore)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "Full URL to scan for malware, phishing, and threats (e.g. \"https://example.com/page\")" }, "strictness": { "type": "integer", "minimum": 0, "maximum": 2, "description": "Scanning strictness 0-2 (0=least strict, 2=most aggressive)" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "security.ipqs.phone_check", "description": "Check phone number for fraud risk \u2014 detects VOIP, prepaid, risky numbers, carrier info, line type (mobile/landline/VOIP), active status, leaked data. Returns fraud score (0-100) and geographic location. Supports international numbers with country filter (IPQualityScore)", "inputSchema": { "type": "object", "properties": { "phone": { "type": "string", "description": "Phone number to check in E.164 or national format (e.g. \"+12125551234\", \"2125551234\")" }, "country": { "type": "string", "description": "ISO 2-letter country code for national format numbers (e.g. \"US\", \"GB\")" }, "strictness": { "type": "integer", "minimum": 0, "maximum": 2, "description": "Fraud detection strictness 0-2" } }, "required": [ "phone" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.chem.resolve", "description": "Convert any chemical identifier to SMILES, InChI, and InChIKey. Input a compound name (e.g. \"aspirin\"), CAS number (e.g. \"50-78-2\"), SMILES, or InChIKey and get all other representations. The only universal chemical ID converter \u2014 essential for chemistry workflows and cross-database lookups (NCI CACTUS)", "inputSchema": { "type": "object", "properties": { "identifier": { "type": "string", "description": "Chemical identifier to resolve \u2014 compound name (e.g. \"aspirin\", \"caffeine\"), CAS number (e.g. \"50-78-2\"), SMILES (e.g. \"CC(=O)Oc1ccccc1C(O)=O\"), or InChIKey (e.g. \"BSYNRYMUTXBXSQ-UHFFFAOYSA-N\")", "minLength": 1 }, "output": { "type": "string", "enum": [ "all", "smiles", "stdinchi", "stdinchikey" ], "description": "Output format: \"all\" (SMILES + InChI + InChIKey), \"smiles\" (canonical SMILES only), \"stdinchi\" (Standard InChI only), \"stdinchikey\" (InChIKey only). Default: \"all\"", "default": "all" } }, "required": [ "identifier" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.chem.formula", "description": "Get molecular formula and molecular weight for any compound by name, CAS number, or SMILES. Returns formula (e.g. \"C9H8O4\" for aspirin) and weight in daltons (e.g. 180.157). Accepts any chemical identifier format (NCI CACTUS)", "inputSchema": { "type": "object", "properties": { "identifier": { "type": "string", "description": "Chemical identifier \u2014 compound name (e.g. \"ibuprofen\"), CAS number (e.g. \"15687-27-1\"), or SMILES string. Returns molecular formula and weight", "minLength": 1 } }, "required": [ "identifier" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.chem.names", "description": "Get all known names, synonyms, CAS numbers, and registry IDs for a chemical compound. Input any identifier (name, CAS, SMILES, InChIKey) and get the full list of aliases. Useful for finding alternative names, trade names, and cross-references (NCI CACTUS)", "inputSchema": { "type": "object", "properties": { "identifier": { "type": "string", "description": "Chemical identifier to look up synonyms for \u2014 compound name, CAS number, SMILES, or InChIKey (e.g. \"aspirin\", \"50-78-2\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Maximum number of names/synonyms to return (1-100). Default: 20", "default": 20 } }, "required": [ "identifier" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "vehicle.safety.recalls", "description": "Search NHTSA vehicle recalls by make, model, and year. Returns campaign number, manufacturer, subject, summary, consequence, remedy, affected components, and units affected. Covers all US recalls from 1966 to present. Essential for automotive safety, insurance, and fleet management agents (NHTSA)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Vehicle manufacturer name (e.g. \"Toyota\", \"Ford\", \"Tesla\", \"BMW\")", "minLength": 1 }, "model": { "type": "string", "description": "Vehicle model name (e.g. \"Camry\", \"Model 3\", \"F-150\", \"X5\")", "minLength": 1 }, "model_year": { "type": "integer", "description": "Model year (e.g. 2023). NHTSA recall data available from 1966 to present", "minimum": 1966, "maximum": 2030 } }, "required": [ "make", "model", "model_year" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "vehicle.safety.complaints", "description": "Search consumer complaints filed with NHTSA about vehicles. Returns incident details including crash/fire flags, injuries, deaths, affected components, and complaint summary. Covers US vehicles from ~1995 to present. Critical for safety research and product liability analysis (NHTSA)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Vehicle manufacturer name (e.g. \"Toyota\", \"Ford\", \"Tesla\", \"Honda\")", "minLength": 1 }, "model": { "type": "string", "description": "Vehicle model name (e.g. \"Camry\", \"Model 3\", \"Civic\")", "minLength": 1 }, "model_year": { "type": "integer", "description": "Model year (e.g. 2023). NHTSA complaint data available from ~1995 to present", "minimum": 1995, "maximum": 2030 } }, "required": [ "make", "model", "model_year" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "vehicle.safety.ratings", "description": "Get NCAP 5-Star crash test safety ratings by make/model/year or vehicle ID. Returns overall rating, frontal crash, side crash, and rollover ratings (1-5 stars). Also shows related complaints, recalls, and investigation counts. Available from ~2011 for US-market vehicles (NHTSA)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Vehicle manufacturer name (e.g. \"Toyota\", \"Honda\"). Required unless vehicle_id is provided" }, "model": { "type": "string", "description": "Vehicle model name (e.g. \"Camry\", \"Civic\"). Required unless vehicle_id is provided" }, "model_year": { "type": "integer", "minimum": 2011, "maximum": 2030, "description": "Model year (e.g. 2023). 5-Star ratings available from ~2011. Required unless vehicle_id is provided" }, "vehicle_id": { "type": "integer", "description": "NHTSA Vehicle ID for full ratings detail (get from initial search). Overrides make/model/year if provided" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "vehicle.safety.investigations", "description": "Search NHTSA defect investigation records by manufacturer and model. Returns investigation number, type (preliminary/engineering analysis), description, latest activity date, and NHTSA action number. Covers active and closed investigations for US vehicles (NHTSA)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Vehicle manufacturer name (e.g. \"Tesla\", \"GM\", \"Ford\")", "minLength": 1 }, "model": { "type": "string", "description": "Vehicle model name to narrow results (e.g. \"Model 3\", \"Bolt EV\")" } }, "required": [ "make" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.pdb.search", "description": "Search 220K+ macromolecular 3D structures in the Protein Data Bank by keyword, protein name, organism, or author. Returns PDB IDs with relevance scores. The canonical database for structural biology, X-ray crystallography, cryo-EM, and NMR structures (RCSB PDB)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query \u2014 keyword, protein name, organism, or author (e.g. \"insulin\", \"hemoglobin\", \"Homo sapiens\", \"Watson\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Maximum number of results (1-50). Default: 10", "default": 10 } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.pdb.structure", "description": "Get full details for a 3D protein structure by PDB ID \u2014 title, experimental method (X-ray/cryo-EM/NMR), resolution, molecular weight, chain counts (protein/DNA/RNA), deposit date, primary citation with DOI and PubMed ID. Essential for drug design and structural analysis (RCSB PDB)", "inputSchema": { "type": "object", "properties": { "pdb_id": { "type": "string", "description": "4-character PDB identifier (e.g. \"4HHB\" for hemoglobin, \"1BNA\" for DNA, \"6LU7\" for SARS-CoV-2 main protease)", "minLength": 4, "maxLength": 4 } }, "required": [ "pdb_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.pdb.ligand", "description": "Get chemical component data for a ligand/small molecule by its 3-letter PDB code \u2014 name, molecular formula, weight, type, formal charge, heavy atom count, SMILES/InChI descriptors. Covers ATP, HEM, NAG, drug molecules, cofactors, ions, and 40K+ chemical entities in the PDB (RCSB PDB)", "inputSchema": { "type": "object", "properties": { "ligand_id": { "type": "string", "description": "Chemical component identifier \u2014 standard 3-letter code (e.g. \"ATP\" for adenosine triphosphate, \"HEM\" for heme, \"NAG\" for N-acetylglucosamine, \"ZN\" for zinc ion)", "minLength": 1, "maxLength": 5 } }, "required": [ "ligand_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.pdb.sequence", "description": "Search protein structures by amino acid sequence similarity (BLAST). Input a protein sequence and find all PDB structures with matching chains. Configure identity cutoff (e.g. 90%) and E-value threshold. Returns PDB entity IDs ranked by similarity score. Essential for homology modeling and structure prediction (RCSB PDB)", "inputSchema": { "type": "object", "properties": { "sequence": { "type": "string", "description": "Protein amino acid sequence in one-letter code (e.g. \"MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH\" \u2014 first 50 residues of human hemoglobin alpha)", "minLength": 10 }, "identity_cutoff": { "type": "number", "minimum": 0.1, "maximum": 1, "description": "Minimum sequence identity (0.1-1.0). Default: 0.9 (90% identical)", "default": 0.9 }, "evalue_cutoff": { "type": "number", "description": "Maximum E-value threshold for BLAST significance. Default: 0.1", "default": 0.1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Maximum number of results (1-50). Default: 10", "default": 10 } }, "required": [ "sequence" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.adzuna.search", "description": "Search job listings across 16+ countries (US, UK, AU, CA, DE, FR, and more) by keyword, location, category, salary range. Returns job title, company, salary, location, and apply URL. 70K+ developer jobs in US alone (Adzuna)", "inputSchema": { "type": "object", "properties": { "what": { "type": "string", "description": "Job search keywords (e.g. \"python developer\", \"marketing manager\", \"nurse\")" }, "where": { "type": "string", "description": "Location (e.g. \"new york\", \"london\", \"berlin\")" }, "country": { "type": "string", "description": "Country code: us, gb, au, ca, de, fr, nl, in, br, pl, nz, za, sg, at, ch, it, ru (default us)", "default": "us" }, "category": { "type": "string", "description": "Job category tag (e.g. \"it-jobs\", \"sales-jobs\", \"engineering-jobs\"). Get tags from adzuna.categories" }, "salary_min": { "type": "number", "description": "Minimum salary filter" }, "salary_max": { "type": "number", "description": "Maximum salary filter" }, "full_time": { "type": "boolean", "description": "Filter full-time jobs only" }, "permanent": { "type": "boolean", "description": "Filter permanent jobs only" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results (1-20, default 10)", "default": 10 }, "page": { "type": "integer", "minimum": 1, "description": "Page number", "default": 1 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.adzuna.categories", "description": "List all job categories available in a country \u2014 IT, Sales, Engineering, HR, Healthcare, Hospitality, and more. Use category tags to filter adzuna.search results (Adzuna)", "inputSchema": { "type": "object", "properties": { "country": { "type": "string", "description": "Country code (default us)", "default": "us" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.adzuna.salary", "description": "Get salary distribution for a job title \u2014 returns histogram of salary buckets with job counts. Example: \"python developer\" in US \u2192 $20K-$140K distribution. Use for salary benchmarking and market research (Adzuna)", "inputSchema": { "type": "object", "properties": { "what": { "type": "string", "description": "Job title or keywords for salary histogram (e.g. \"python developer\", \"data scientist\")" }, "where": { "type": "string", "description": "Location for salary data" }, "country": { "type": "string", "description": "Country code (default us)", "default": "us" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "sports.bdl.games", "description": "Get NBA and NFL game results by date \u2014 scores, teams, status (Final/In Progress/Scheduled). Filter by date, season, or team. Covers all NBA and NFL games with real-time scores (BallDontLie)", "inputSchema": { "type": "object", "properties": { "date": { "type": "string", "description": "Game date (YYYY-MM-DD, e.g. \"2026-03-29\"). Returns all games on that date" }, "season": { "type": "integer", "description": "Season year (e.g. 2025 for 2025-26 season)" }, "team_id": { "type": "integer", "description": "Filter by team ID (get IDs from bdl.teams)" }, "sport": { "type": "string", "enum": [ "nba", "nfl" ], "description": "Sport league: \"nba\" (default) or \"nfl\"", "default": "nba" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "sports.bdl.teams", "description": "List NBA and NFL teams with conference, division, city, and abbreviation. Filter by conference (East/West for NBA, AFC/NFC for NFL) or division (BallDontLie)", "inputSchema": { "type": "object", "properties": { "conference": { "type": "string", "description": "Filter by conference (e.g. \"East\", \"West\" for NBA; \"AFC\", \"NFC\" for NFL)" }, "division": { "type": "string", "description": "Filter by division (e.g. \"Atlantic\", \"Pacific\" for NBA)" }, "sport": { "type": "string", "enum": [ "nba", "nfl" ], "description": "Sport league: \"nba\" (default) or \"nfl\"", "default": "nba" }, "limit": { "type": "integer", "minimum": 1, "maximum": 30, "description": "Max results (1-30, default 30)", "default": 30 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "sports.bdl.players", "description": "Search NBA players by name \u2014 returns position, jersey number, and current team. Example: \"lebron\" \u2192 LeBron James #23 F, Los Angeles Lakers (BallDontLie)", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Search by player name (e.g. \"lebron\", \"curry\", \"mahomes\")" }, "team_id": { "type": "integer", "description": "Filter by team ID" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "address.postal.lookup", "description": "Look up a postal/ZIP code in 60+ countries \u2014 returns city name, state/region, and lat/lon coordinates. Supports US, UK, Germany, France, Japan, Brazil, India, Australia, and 50+ more countries. Provide country code (ISO 2-letter) + postal code (Zippopotam.us)", "inputSchema": { "type": "object", "properties": { "country_code": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"us\", \"de\", \"gb\", \"fr\", \"jp\", \"br\", \"in\", \"au\"). Supports 60+ countries", "minLength": 2, "maxLength": 2 }, "postal_code": { "type": "string", "description": "Postal/ZIP code (e.g. \"90210\" for US, \"10115\" for Germany, \"SW1A\" for UK, \"75001\" for France)", "minLength": 1 } }, "required": [ "country_code", "postal_code" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "logistics.dhl.track", "description": "Track a DHL shipment by tracking number \u2014 returns current status, delivery events timeline, origin/destination, estimated delivery date, and service type. Supports all DHL services: Express, Parcel, eCommerce, Freight. Official DHL data for 220+ countries (DHL)", "inputSchema": { "type": "object", "properties": { "tracking_number": { "type": "string", "description": "DHL tracking number (e.g. \"00340434292135100186\" for DHL Paket, \"1234567890\" for DHL Express). Supports all DHL services: Express, Parcel, eCommerce, Freight", "minLength": 1 } }, "required": [ "tracking_number" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "address.ukpost.lookup", "description": "Look up a UK postcode \u2014 returns district, region, country, ward, parish, parliamentary constituency, and lat/lon coordinates. Backed by ONS/Ordnance Survey data. Example: \"SW1A 1AA\" \u2192 Westminster, London (Postcodes.io)", "inputSchema": { "type": "object", "properties": { "postcode": { "type": "string", "description": "UK postcode to look up (e.g. \"SW1A 1AA\" for Westminster, \"EC2R 8AH\" for City of London, \"M1 1AA\" for Manchester). Returns district, region, country, lat/lon, parliamentary constituency", "minLength": 1 } }, "required": [ "postcode" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "address.ukpost.nearest", "description": "Find nearest UK postcodes to a lat/lon coordinate \u2014 returns postcodes sorted by distance with district info. Use for reverse geocoding in the UK (Postcodes.io)", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude (e.g. 51.5074 for London)" }, "lon": { "type": "number", "description": "Longitude (e.g. -0.1278 for London)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 10, "description": "Max results (1-10, default 5)", "default": 5 } }, "required": [ "lat", "lon" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "address.ukpost.validate", "description": "Check if a UK postcode is valid and exists \u2014 returns true/false. Use for form validation or data cleaning (Postcodes.io)", "inputSchema": { "type": "object", "properties": { "postcode": { "type": "string", "description": "UK postcode to validate (e.g. \"SW1A 1AA\"). Returns true if valid format and exists", "minLength": 1 } }, "required": [ "postcode" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "logistics.shipengine.rates", "description": "Compare shipping rates across multiple carriers (USPS, UPS, FedEx, DHL) for a package. Provide origin/destination ZIP codes, weight in pounds, and optional dimensions. Returns sorted rates with price, delivery time, and service type. Up to 84% off retail rates (ShipEngine)", "inputSchema": { "type": "object", "properties": { "from_zip": { "type": "string", "description": "Origin US ZIP code (e.g. \"10001\" for NYC)", "minLength": 1 }, "to_zip": { "type": "string", "description": "Destination US ZIP code (e.g. \"90210\" for Beverly Hills)", "minLength": 1 }, "weight_lb": { "type": "number", "description": "Package weight in pounds (e.g. 5)", "minimum": 0.1 }, "length": { "type": "number", "description": "Package length in inches" }, "width": { "type": "number", "description": "Package width in inches" }, "height": { "type": "number", "description": "Package height in inches" }, "from_country": { "type": "string", "description": "Origin country code (default US)", "default": "US" }, "to_country": { "type": "string", "description": "Destination country code (default US)", "default": "US" } }, "required": [ "from_zip", "to_zip", "weight_lb" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "logistics.shipengine.validate", "description": "Validate and standardize a US address \u2014 returns USPS-verified address with corrected spelling, ZIP+4, and validation status. Catches typos, missing info, and invalid addresses before shipping (ShipEngine)", "inputSchema": { "type": "object", "properties": { "address_line1": { "type": "string", "description": "Street address (e.g. \"1 E 161 St\")", "minLength": 1 }, "address_line2": { "type": "string", "description": "Apartment, suite, unit (e.g. \"Apt 4B\")" }, "city": { "type": "string", "description": "City name (e.g. \"Bronx\")" }, "state": { "type": "string", "description": "State code (e.g. \"NY\")" }, "postal_code": { "type": "string", "description": "ZIP code (e.g. \"10451\")" }, "country": { "type": "string", "description": "Country code (default US)", "default": "US" } }, "required": [ "address_line1" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "logistics.shipengine.carriers", "description": "List all connected shipping carriers with their IDs and codes. Shows which carriers are available for rate comparison (USPS, UPS, FedEx, DHL, etc.) (ShipEngine)", "inputSchema": { "type": "object", "properties": { "filter": { "type": "string", "description": "Optional filter on carrier name (e.g. \"ups\", \"usps\"). Returns all connected carriers if omitted" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "weather.weatherapi.current", "description": "Get current weather conditions for any location worldwide \u2014 temperature, wind, humidity, pressure, UV index, cloud cover, feels-like temp. Accepts city name, coordinates, zip code, or airport code. 100K+ stations globally (WeatherAPI.com)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Location query \u2014 city name (e.g. \"London\"), coordinates (\"48.8,2.35\"), US zip (\"10001\"), UK postcode (\"SW1\"), IP address, or IATA airport code (\"JFK\")", "minLength": 1 } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "weather.weatherapi.forecast", "description": "Get 3-day weather forecast \u2014 daily min/max temperature, conditions, wind, precipitation, humidity, rain/snow chance, UV index. Accepts any location query (WeatherAPI.com)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Location query \u2014 city name, coordinates, zip code, or airport code", "minLength": 1 }, "days": { "type": "integer", "minimum": 1, "maximum": 3, "description": "Forecast days (1-3, default 3)", "default": 3 } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "weather.weatherapi.astronomy", "description": "Get sunrise, sunset, moonrise, moonset times and moon phase for any location and date. Returns moon illumination percentage and phase name (WeatherAPI.com)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Location query \u2014 city name, coordinates, or zip code", "minLength": 1 }, "date": { "type": "string", "description": "Date for astronomy data (YYYY-MM-DD, default today)" } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "weather.weatherapi.search", "description": "Search and autocomplete location names \u2014 returns matching cities with coordinates. Type partial name (e.g. \"lon\" \u2192 London, \"mos\" \u2192 Moscow). Use result coordinates with other weather tools (WeatherAPI.com)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search query \u2014 partial city name for autocomplete (e.g. \"lon\" \u2192 London, \"mos\" \u2192 Moscow)", "minLength": 1 } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "dev.code.execute", "description": "Execute source code in a sandboxed environment \u2014 71 programming languages supported (Python, JavaScript, Java, C++, Go, Rust, C#, Bash, Ruby, PHP, and 60+ more). Returns stdout, stderr, execution time, and memory usage. Safe sandboxed execution with CPU/memory limits. Use code.languages to get language IDs (Judge0 CE)", "inputSchema": { "type": "object", "properties": { "language_id": { "type": "integer", "description": "Language ID from code.languages (e.g. 71=Python 3, 63=JavaScript, 62=Java, 54=C++, 60=Go, 73=Rust, 51=C#, 46=Bash). Call code.languages for full list" }, "source_code": { "type": "string", "description": "Source code to execute", "minLength": 1 }, "stdin": { "type": "string", "description": "Standard input to feed to the program" }, "cpu_time_limit": { "type": "number", "description": "CPU time limit in seconds (default 5, max 15)" }, "memory_limit": { "type": "number", "description": "Memory limit in KB (default 128000 = 128MB)" } }, "required": [ "language_id", "source_code" ] }, "annotations": { "readOnlyHint": false, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "dev.code.languages", "description": "List all 71 available programming languages and their IDs for code execution. Common IDs: 71=Python 3.8, 63=JavaScript (Node.js), 62=Java, 54=C++ (GCC), 60=Go, 73=Rust, 51=C#, 46=Bash. Returns full list with compiler/interpreter versions (Judge0 CE)", "inputSchema": { "type": "object", "properties": { "filter": { "type": "string", "description": "Optional filter \u2014 substring match on language name (e.g. \"python\", \"java\", \"rust\"). Returns all 71 languages if omitted" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "web.scrape.extract", "description": "Extract raw HTML from any URL \u2014 cheapest web scraping API ($0.00013 for simple sites). Returns decoded HTML content, HTTP status code, and content length. Use for data extraction, content analysis, or price monitoring. Handles anti-bot protection automatically (Zyte)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to scrape \u2014 returns raw HTML content. Fast and cheap ($0.00013 for simple sites). Example: \"https://example.com\"" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "web.scrape.browser", "description": "Render a URL with headless browser and return JS-rendered HTML. Use for SPAs, React/Vue apps, or pages with dynamic content that raw HTTP cannot capture. Returns fully rendered DOM as HTML text (Zyte)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to render with headless browser \u2014 returns JS-rendered HTML. Use for SPAs, dynamic content. More expensive than extract. Example: \"https://example.com\"" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "web.scrape.screenshot", "description": "Capture a full-page screenshot of any URL \u2014 returns base64-encoded PNG image. Use for visual verification, monitoring, or archiving. Headless browser renders the page before capture (Zyte)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to screenshot \u2014 returns base64-encoded PNG image. Use for visual verification or page capture. Example: \"https://example.com\"" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "vehicle.carmarket.search", "description": "Search millions of active US car listings by make, model, year, price range, mileage, ZIP code, and radius. Returns VIN, price, miles, dealer info, Carfax status, and days on market. Filter by seller type (dealer/private) and color. Data from all major US marketplaces (MarketCheck)", "inputSchema": { "type": "object", "properties": { "make": { "type": "string", "description": "Car manufacturer (e.g. \"Toyota\", \"Honda\", \"BMW\", \"Tesla\")" }, "model": { "type": "string", "description": "Car model (e.g. \"Camry\", \"Civic\", \"Model 3\")" }, "year": { "type": "integer", "description": "Model year (e.g. 2023, 2024)" }, "price_min": { "type": "number", "description": "Minimum price in USD" }, "price_max": { "type": "number", "description": "Maximum price in USD" }, "miles_max": { "type": "number", "description": "Maximum mileage" }, "zip": { "type": "string", "description": "US ZIP code to search near (e.g. \"10001\")" }, "radius": { "type": "number", "description": "Search radius in miles from ZIP (max 100 on free tier)" }, "seller_type": { "type": "string", "enum": [ "dealer", "private" ], "description": "Filter by seller type" }, "exterior_color": { "type": "string", "description": "Filter by exterior color (e.g. \"White\", \"Black\", \"Red\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 }, "start": { "type": "integer", "minimum": 0, "description": "Offset for pagination" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "vehicle.carmarket.listing", "description": "Get full details for a specific car listing by ID \u2014 VIN, price, MSRP, mileage, full build specs (engine, transmission, drivetrain, fuel type), dealer contact, Carfax 1-owner status, days on market, photos. Get listing IDs from carmarket.search (MarketCheck)", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "MarketCheck listing ID (e.g. \"3TMCZ5AN5PM564843-883937ce-f335\"). Get IDs from carmarket.search results", "minLength": 1 } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "security.threatintel.reputation", "description": "Get domain reputation score (0-100) with detailed security test results \u2014 WHOIS age, SSL validity, mail server config, blacklist status, and more. Higher score = safer domain. Essential for security agents evaluating domain trustworthiness (Threat Intelligence Platform)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to check reputation (e.g. \"google.com\", \"suspicious-site.xyz\"). Returns reputation score 0-100 and security test results", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "security.threatintel.malware", "description": "Check if a domain is associated with malware, phishing, or other threats. Returns safe score (0-100) and detailed warning descriptions. Use for URL safety verification before agent navigation (Threat Intelligence Platform)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to check for malware and phishing (e.g. \"example.com\"). Returns safe score 0-100 and warning details", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "security.threatintel.infrastructure", "description": "Analyze domain infrastructure \u2014 all associated IPv4 addresses, geolocation (country, city, region), subnets, and resource types (web, mail, DNS). Reveals hosting setup, CDN usage, and geographic distribution (Threat Intelligence Platform)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to analyze infrastructure (e.g. \"google.com\"). Returns all associated IPs, geolocation, subnets, and resource types", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "podcasts.listennotes.search", "description": "Full-text search across 3.7M+ podcasts and 186M+ episodes. Search by keyword, filter by language and genre, sort by relevance or date. Returns episode titles, podcast names, audio URLs, and duration. The most comprehensive podcast search API available (Listen Notes)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search query \u2014 full-text search across 186M+ podcast episodes and 3.7M+ podcasts (e.g. \"artificial intelligence\", \"startup funding\", \"true crime\")", "minLength": 1 }, "type": { "type": "string", "enum": [ "episode", "podcast" ], "description": "Search type: \"episode\" (default) searches episode titles/descriptions, \"podcast\" searches podcast-level metadata", "default": "episode" }, "language": { "type": "string", "description": "ISO 639-1 language code (e.g. \"en\", \"es\", \"fr\"). Filters results by podcast language" }, "genre_ids": { "type": "string", "description": "Comma-separated genre IDs to filter (e.g. \"93,127\" for Business+Technology). See Listen Notes genre list" }, "sort_by_date": { "type": "boolean", "description": "Sort by date (true) or relevance (false, default)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 10, "description": "Max results (1-10, default 10)", "default": 10 }, "offset": { "type": "integer", "minimum": 0, "description": "Offset for pagination" } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "podcasts.listennotes.podcast", "description": "Get full details for a podcast by Listen Notes ID \u2014 title, publisher, description, episode count, language, country, website, genres, and latest publish date. Use IDs from listennotes.search or listennotes.best (Listen Notes)", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "Listen Notes podcast ID (e.g. \"4d3fe717742d4963a85562e9f84d8c79\"). Get IDs from listennotes.search or listennotes.best", "minLength": 1 } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "podcasts.listennotes.best", "description": "Get curated lists of the best podcasts by genre \u2014 Technology (127), Business (93), TV & Film (68), Sports (77), Leisure (82), and 60+ more genres. Paginated, returns podcast titles, publishers, episode counts, and descriptions (Listen Notes)", "inputSchema": { "type": "object", "properties": { "genre_id": { "type": "integer", "description": "Genre ID to filter (e.g. 93=Business, 127=Technology, 68=TV & Film, 82=Leisure, 77=Sports). Omit for overall best" }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)", "default": 1 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "music.audd.recognize", "description": "Identify a song from an audio file URL \u2014 like Shazam for AI agents. Analyzes audio fingerprint against 80M+ tracks and returns artist, title, album, release date, plus Spotify and Apple Music links. Accepts MP3, WAV, OGG, or any audio URL (AudD)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL of audio file to identify (MP3, WAV, OGG, etc.). The API analyzes the audio and matches it against 80M+ tracks. Example: \"https://example.com/song.mp3\"" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "music.audd.lyrics", "description": "Search for song lyrics by artist name, song title, or both. Returns full lyrics text, artist, title, and metadata. Query examples: \"imagine john lennon\", \"bohemian rhapsody\", \"taylor swift love story\" (AudD)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Search query for lyrics \u2014 artist name, song title, or both (e.g. \"imagine john lennon\", \"bohemian rhapsody\", \"taylor swift love story\")", "minLength": 1 } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.materials.search", "description": "Search 150,000+ inorganic materials by chemical formula, elements, band gap, stability, or metallic character. Returns DFT-computed properties: band gap, formation energy, density, crystal system. Filter semiconductors (band_gap 1-3 eV), stable battery cathodes (elements Li,Fe,O + is_stable), or metals. DOE/Lawrence Berkeley Lab data, CC BY 4.0 (Materials Project)", "inputSchema": { "type": "object", "properties": { "formula": { "type": "string", "description": "Chemical formula to search (e.g. \"Si\", \"Fe2O3\", \"LiFePO4\"). Exact or reduced formula" }, "elements": { "type": "string", "description": "Comma-separated elements to filter (e.g. \"Li,Fe,O\" \u2014 returns materials containing these elements)" }, "band_gap_min": { "type": "number", "description": "Minimum band gap in eV (e.g. 1.0). Use with band_gap_max for range filter" }, "band_gap_max": { "type": "number", "description": "Maximum band gap in eV (e.g. 3.0). Use with band_gap_min for range filter" }, "is_stable": { "type": "boolean", "description": "Filter for thermodynamically stable materials only (energy_above_hull = 0)" }, "is_metal": { "type": "boolean", "description": "Filter for metals (true) or non-metals (false)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max results (1-50, default 10)", "default": 10 }, "skip": { "type": "integer", "minimum": 0, "description": "Offset for pagination" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.materials.details", "description": "Get full DFT-computed properties for a material by Materials Project ID (e.g. mp-149 for silicon). Returns: band gap, formation energy, thermodynamic stability, density, crystal structure, spacegroup, magnetism, bulk/shear modulus, Poisson ratio, Fermi energy, database cross-references. 150K+ materials (Materials Project)", "inputSchema": { "type": "object", "properties": { "material_id": { "type": "string", "description": "Materials Project ID (e.g. \"mp-149\" for silicon, \"mp-19017\" for LiFePO4). Get IDs from materials.search", "minLength": 1 } }, "required": [ "material_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "science.materials.elasticity", "description": "Get mechanical/elastic properties for a material: bulk modulus, shear modulus (Voigt-Reuss-Hill averages), universal anisotropy index, Poisson ratio, and full 6x6 elastic tensor (IEEE format). Essential for structural materials screening and mechanical simulations (Materials Project)", "inputSchema": { "type": "object", "properties": { "material_id": { "type": "string", "description": "Materials Project ID (e.g. \"mp-149\"). Returns bulk/shear modulus, Poisson ratio, elastic tensor", "minLength": 1 } }, "required": [ "material_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "logistics.tracking.register", "description": "Register a tracking number to begin monitoring shipment status. Auto-detects carrier from 3,200+ supported carriers worldwide (UPS, FedEx, DHL, USPS, China Post, Royal Mail, etc.). Must be called before tracking.status. Returns detected carrier and registration status. Consumes quota \u2014 200 free/month (17TRACK)", "inputSchema": { "type": "object", "properties": { "tracking_number": { "type": "string", "description": "Package tracking number (e.g. \"1Z999AA10123456784\" for UPS, \"9400111899560243888780\" for USPS). Carrier is auto-detected from 3,200+ supported carriers", "minLength": 3, "maxLength": 50 }, "tag": { "type": "string", "maxLength": 50, "description": "Optional label for this shipment (e.g. order ID, customer reference). Up to 50 characters" } }, "required": [ "tracking_number" ] }, "annotations": { "readOnlyHint": false, "destructiveHint": false, "idempotentHint": false, "openWorldHint": true } }, { "name": "logistics.tracking.status", "description": "Get full tracking timeline for a registered package \u2014 latest status, all carrier scan events with timestamps and locations, delivery milestones, transit days, origin/destination countries. Supports 3,200+ carriers across 220 countries. Call tracking.register first if number is not yet registered (17TRACK)", "inputSchema": { "type": "object", "properties": { "tracking_number": { "type": "string", "description": "Tracking number previously registered with tracking.register. Returns full event timeline, carrier info, milestones, and delivery status", "minLength": 3, "maxLength": 50 } }, "required": [ "tracking_number" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "logistics.tracking.list", "description": "List all tracking numbers registered in your account with status summary \u2014 package status, latest event, transit days, registration time. Paginated. Filter by status: NotFound, InTransit, Delivered, Expired, Exception (17TRACK)", "inputSchema": { "type": "object", "properties": { "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)", "default": 1 }, "page_size": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Results per page (1-100, default 20)", "default": 20 }, "status": { "type": "string", "enum": [ "NotFound", "InTransit", "Delivered", "Expired", "Exception" ], "description": "Filter by package status" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "account.analytics.usage", "description": "Get your API usage summary \u2014 total calls, total cost, cache hit rate, average latency, and unique tools used. Filter by period: 1 day, 7 days, or 30 days. See how efficiently you are using the platform. Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "period": { "type": "string", "enum": [ "1d", "7d", "30d" ], "description": "Time period for usage stats: \"1d\" (24 hours), \"7d\" (7 days), or \"30d\" (30 days). Default: \"7d\"", "default": "7d" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "account.analytics.tools", "description": "Get per-tool usage breakdown \u2014 calls, cost, cache hits, average latency, last used. Sort by cost (highest spend), calls (most used), or latency (slowest). Identify your most-used and most-expensive tools. Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "sort": { "type": "string", "enum": [ "cost", "calls", "latency" ], "description": "Sort tools by: \"cost\" (highest spend), \"calls\" (most used), or \"latency\" (slowest). Default: \"calls\"", "default": "calls" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max number of tools to return (1-100). Default: 20", "default": 20 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "account.analytics.timeseries", "description": "Get time-series usage data \u2014 calls, cost, cache hits per hour or day over a period. Visualize usage patterns and trends. Choose granularity: hourly (for 1d period) or daily (for 7d/30d). Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "period": { "type": "string", "enum": [ "1d", "7d", "30d" ], "description": "Time period: \"1d\", \"7d\", or \"30d\". Default: \"7d\"", "default": "7d" }, "granularity": { "type": "string", "enum": [ "hour", "day" ], "description": "Time bucket granularity: \"hour\" or \"day\". Default: \"day\"", "default": "day" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "platform.quality.tool", "description": "Get quality metrics for any tool \u2014 uptime percentage, p50/p95 latency, error rate, total calls in last 24h. Check reliability before calling expensive tools. Updated every 10 minutes. Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "tool_id": { "type": "string", "description": "Tool ID to get quality metrics for (e.g. \"crypto.get_price\", \"weather.get_current\")", "minLength": 1 } }, "required": [ "tool_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "platform.quality.rankings", "description": "Get ranked list of tools by quality \u2014 sort by uptime (most reliable), latency (fastest), or error_rate (fewest errors). Filter by category (e.g. \"crypto\", \"weather\"). Discover the best tools for your use case. Free, no charge (APIbase)", "inputSchema": { "type": "object", "properties": { "sort": { "type": "string", "enum": [ "uptime", "latency", "error_rate" ], "description": "Sort by: \"uptime\" (highest availability), \"latency\" (fastest p50), or \"error_rate\" (lowest errors). Default: \"uptime\"", "default": "uptime" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max number of tools to return (1-100). Default: 20", "default": 20 }, "category": { "type": "string", "description": "Filter by tool category prefix (e.g. \"crypto\", \"weather\", \"finance\")" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "platform.batch.call", "description": "Execute up to 20 tool calls in a single request with parallel execution (max 10 concurrent). Each call runs the full pipeline independently with its own billing. Returns array of results with per-call status, data, cost, and duration. Save 5x round-trips vs sequential calls. Batch wrapper is free \u2014 you pay only for individual tool calls (APIbase)", "inputSchema": { "type": "object", "properties": { "calls": { "type": "array", "items": { "type": "object", "properties": { "tool_id": { "type": "string", "description": "Tool ID to call (e.g. \"crypto.get_price\")", "minLength": 1 }, "params": { "type": "object", "additionalProperties": {}, "description": "Parameters for the tool call" }, "idempotency_key": { "type": "string", "description": "Optional idempotency key for this specific call" } }, "required": [ "tool_id", "params" ] }, "description": "Array of tool calls to execute in parallel (max 20)", "minItems": 1, "maxItems": 20 }, "max_parallel": { "type": "integer", "minimum": 1, "maximum": 10, "description": "Max concurrent calls (1-10). Default: 10", "default": 10 } }, "required": [ "calls" ] }, "annotations": { "readOnlyHint": false, "destructiveHint": false, "idempotentHint": false, "openWorldHint": true } }, { "name": "jobs.theirstack.search", "description": "Search 181M+ job postings worldwide \u2014 filter by keywords, country, remote, tech stack, recency. Returns title, company, location, salary range, post date. Job market intelligence for hiring analysis and talent sourcing (TheirStack)", "inputSchema": { "type": "object", "properties": { "keywords": { "type": "string", "description": "Comma-separated job title keywords (e.g. \"python developer, backend engineer\"). Matches job_title_or filter" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"US\", \"DE\", \"IN\")" }, "remote": { "type": "boolean", "description": "Filter remote-only jobs" }, "days": { "type": "integer", "minimum": 1, "maximum": 90, "description": "Max age in days (1-90). Only jobs posted within this window" }, "technologies": { "type": "string", "description": "Comma-separated tech stack filter (e.g. \"kubernetes, python, react\"). Matches technologies_or" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.theirstack.companies", "description": "Find companies by technology stack \u2014 filter by technologies (kubernetes, react, python...), country, minimum active jobs. Returns company name, URL, job count, tech stack. Identify employers using specific technologies (TheirStack)", "inputSchema": { "type": "object", "properties": { "technologies": { "type": "string", "description": "Comma-separated tech stack filter (e.g. \"kubernetes, docker, aws\"). Find companies using these technologies" }, "country": { "type": "string", "description": "ISO 3166-1 alpha-2 country code (e.g. \"US\", \"DE\", \"IN\")" }, "min_jobs": { "type": "integer", "minimum": 1, "description": "Minimum number of active job postings" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.jooble.search", "description": "Search aggregated job listings across 70+ countries \u2014 filter by keywords, location, radius, salary, company name. Returns title, company, location, salary, source, direct link. 9M+ active listings from thousands of job boards (Jooble)", "inputSchema": { "type": "object", "properties": { "keywords": { "type": "string", "description": "Job search keywords (e.g. \"python developer\", \"marketing manager\", \"nurse\")" }, "location": { "type": "string", "description": "Location (e.g. \"New York\", \"London\", \"Berlin\", \"Remote\")" }, "radius": { "type": "string", "enum": [ "0", "4", "8", "16", "26", "40", "80" ], "description": "Search radius in km from location: 0, 4, 8, 16, 26, 40, or 80" }, "salary": { "type": "number", "description": "Minimum salary filter (numeric)" }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)", "default": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results per page (1-20, default 10)", "default": 10 }, "company_search": { "type": "boolean", "description": "Set true to search by company name instead of job title" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.arbeitnow.browse", "description": "Browse European job listings \u2014 100 jobs per page sorted by newest. Returns title, company, location, remote flag, tags, job types, direct link. Updated hourly. EU-focused: Germany, Austria, Switzerland, Netherlands, and more. Open public API (Arbeitnow)", "inputSchema": { "type": "object", "properties": { "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1). Each page returns ~100 EU job listings sorted by newest first. No server-side search \u2014 use page to browse", "default": 1 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.reed.search", "description": "Search UK job listings \u2014 filter by keywords, location, distance, salary range (GBP), contract type (permanent/contract/temp), full/part time. Returns title, company, salary, applications count, direct link. UK largest job board (Reed.co.uk)", "inputSchema": { "type": "object", "properties": { "keywords": { "type": "string", "description": "Job search keywords (e.g. \"python developer\", \"data scientist\", \"nurse\")" }, "location": { "type": "string", "description": "UK location \u2014 city, town, or postcode (e.g. \"London\", \"Manchester\", \"SW1A 1AA\")" }, "distance": { "type": "integer", "minimum": 0, "description": "Search radius in miles from location (default 10)" }, "salary_min": { "type": "number", "description": "Minimum annual salary in GBP (e.g. 30000)" }, "salary_max": { "type": "number", "description": "Maximum annual salary in GBP (e.g. 80000)" }, "permanent": { "type": "boolean", "description": "Filter permanent positions only" }, "contract": { "type": "boolean", "description": "Filter contract positions only" }, "full_time": { "type": "boolean", "description": "Filter full-time positions only" }, "part_time": { "type": "boolean", "description": "Filter part-time positions only" }, "limit": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Max results (1-100, default 25)", "default": 25 }, "skip": { "type": "integer", "minimum": 0, "description": "Number of results to skip for pagination (must be divisible by limit)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.reed.details", "description": "Get full details of a UK job listing by ID \u2014 title, company, full salary info (min/max GBP, annual/hourly/daily), contract type, full/part time, application count, full HTML description, external apply URL. Use job IDs from reed.search results (Reed.co.uk)", "inputSchema": { "type": "object", "properties": { "job_id": { "type": "integer", "description": "Reed job ID (from search results). Example: 56448344" } }, "required": [ "job_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "jobs.remotive.search", "description": "Search curated remote-only job listings \u2014 filter by keywords and category (software-dev, design, marketing, data, devops, etc.). Returns title, company, salary, job type, location requirements, tags. Global remote positions only (Remotive)", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Job search keywords (e.g. \"python\", \"react developer\", \"product manager\")" }, "category": { "type": "string", "description": "Job category slug: software-dev, design, customer-support, writing, marketing, sales, product, business, data, devops, finance, hr, qa, all-others" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Max results (1-50, default 20)", "default": 20 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ecommerce.amazon.search", "description": "Search Amazon products by keyword \u2014 filter by price range, sort by relevance/price/rating/reviews/newest. Returns title, ASIN, price, rating, Prime flag, image. 12 marketplaces: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (Canopy API)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search keywords (e.g. \"wireless headphones\", \"raspberry pi 5\")" }, "domain": { "type": "string", "description": "Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)", "default": "US" }, "page": { "type": "integer", "minimum": 1, "description": "Page number for pagination" }, "sort": { "type": "string", "enum": [ "relevance", "price_asc", "price_desc", "rating", "reviews", "newest" ], "description": "Sort order: relevance, price_asc, price_desc, rating, reviews, newest" }, "price_min": { "type": "number", "description": "Minimum price filter (in marketplace currency)" }, "price_max": { "type": "number", "description": "Maximum price filter (in marketplace currency)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ecommerce.amazon.product", "description": "Get full Amazon product details by ASIN \u2014 title, brand, price, rating, stock status, feature bullets, categories, seller name. Use ASINs from canopy.search. 12 Amazon marketplaces supported (Canopy API)", "inputSchema": { "type": "object", "properties": { "asin": { "type": "string", "description": "Amazon ASIN product ID (e.g. \"B0CRSNCJ6Y\"). Get ASINs from canopy.search" }, "domain": { "type": "string", "description": "Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)", "default": "US" } }, "required": [ "asin" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ecommerce.amazon.offers", "description": "Get all third-party seller offers for an Amazon product \u2014 price, condition (new/used), seller name & rating, Buy Box winner flag, Fulfilled by Amazon, delivery estimate. Price comparison across sellers (Canopy API)", "inputSchema": { "type": "object", "properties": { "asin": { "type": "string", "description": "Amazon ASIN product ID. Returns all third-party offers with Buy Box winner, seller ratings, delivery info" }, "domain": { "type": "string", "description": "Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)", "default": "US" } }, "required": [ "asin" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ecommerce.amazon.deals", "description": "Browse current Amazon deals \u2014 original price vs deal price, product title, ASIN, deal link. Paginated, 500+ active deals. 12 Amazon marketplaces (Canopy API)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Amazon marketplace: US, UK, CA, DE, FR, IT, ES, AU, IN, MX, BR, JP (default US)", "default": "US" }, "page": { "type": "integer", "minimum": 1, "description": "Page number (default 1)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "scraping.spider.scrape", "description": "Scrape any web page and get clean content \u2014 markdown (default), plain text, or raw HTML. Handles JavaScript rendering, anti-bot bypass, proxy rotation. Returns LLM-ready output. Cheapest web scraper with PAYG pricing (Spider.cloud)", "inputSchema": { "type": "object", "properties": { "url": { "type": "string", "description": "URL to scrape (e.g. \"https://example.com/page\")" }, "format": { "type": "string", "enum": [ "markdown", "text", "raw", "commonmark" ], "description": "Output format: markdown (default, best for LLMs), text (plain), raw (HTML), commonmark", "default": "markdown" }, "readability": { "type": "boolean", "description": "Enable readability mode \u2014 pre-processes page for LLM consumption" }, "wait_for": { "type": "integer", "minimum": 0, "maximum": 30000, "description": "Wait N ms for JS to render before scraping (0-30000)" } }, "required": [ "url" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "scraping.spider.search", "description": "Web search that returns page titles, descriptions, and URLs. Combine with spider.scrape to get full content. Results ranked by relevance (Spider.cloud)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Web search query (e.g. \"best MCP servers 2026\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results (1-20, default 5)", "default": 5 } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "media.imgflip.memes", "description": "Get top 100 popular meme templates \u2014 Drake Hotline Bling, Two Buttons, Distracted Boyfriend, and more. Returns template ID, name, image URL, box count. Use IDs with imgflip.caption to generate memes (Imgflip)", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Optional: filter memes by name (client-side). Returns top 100 popular meme templates." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "media.imgflip.caption", "description": "Generate a captioned meme image from a template ID + top/bottom text. Returns direct image URL. Use imgflip.memes to find template IDs. 100K+ templates available (Imgflip)", "inputSchema": { "type": "object", "properties": { "template_id": { "type": "string", "description": "Meme template ID from imgflip.memes (e.g. \"181913649\" for Drake Hotline Bling, \"87743020\" for Two Buttons)" }, "top_text": { "type": "string", "description": "Top text on the meme" }, "bottom_text": { "type": "string", "description": "Bottom text on the meme" } }, "required": [ "template_id" ] }, "annotations": { "readOnlyHint": false, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "recipes.cocktail.search", "description": "Search 10,000+ cocktail recipes by name or filter by ingredient. Returns name, category, glass type, instructions, ingredients with measures, image. Search \"margarita\" or filter by \"Vodka\" (TheCocktailDB)", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Cocktail name to search (e.g. \"margarita\", \"mojito\", \"old fashioned\")" }, "ingredient": { "type": "string", "description": "Filter by ingredient (e.g. \"Vodka\", \"Rum\", \"Gin\"). Returns cocktails containing this ingredient. Use name OR ingredient, not both." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "recipes.cocktail.random", "description": "Get a random cocktail recipe with full details \u2014 name, category, glass, instructions, ingredients, measures, image. Great for discovery and recommendations (TheCocktailDB)", "inputSchema": { "type": "object", "properties": { "count": { "type": "integer", "minimum": 1, "maximum": 1, "description": "Always returns 1 random cocktail with full recipe", "default": 1 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "developer.github.search", "description": "Search GitHub repositories by keyword, language, stars, topics. Returns name, description, stars, forks, language, license, owner. Sort by stars/forks/updated. 86K+ MCP repos, 372M+ total repos (GitHub API)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query (e.g. \"mcp server\", \"react framework\", \"language:python stars:>1000\")" }, "sort": { "type": "string", "enum": [ "stars", "forks", "updated", "help-wanted-issues" ], "description": "Sort by: stars (default), forks, updated, help-wanted-issues", "default": "stars" }, "limit": { "type": "integer", "minimum": 1, "maximum": 30, "description": "Max results (1-30, default 10)", "default": 10 } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "developer.github.user", "description": "Get a GitHub user profile \u2014 name, bio, public repos count, followers, company, location, join date. Works for users and organizations (GitHub API)", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "GitHub username (e.g. \"torvalds\", \"whiteknightonhorse\")" } }, "required": [ "username" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "developer.github.repo", "description": "Get full details of a GitHub repository \u2014 description, stars, forks, language, topics, license, last update. Public repos only (GitHub API)", "inputSchema": { "type": "object", "properties": { "owner": { "type": "string", "description": "Repository owner (e.g. \"facebook\", \"microsoft\")" }, "repo": { "type": "string", "description": "Repository name (e.g. \"react\", \"vscode\")" } }, "required": [ "owner", "repo" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "knowledge.wikidata.search", "description": "Search 100M+ structured entities in Wikidata \u2014 people, companies, places, concepts. Returns entity ID, label, description. Use IDs with wikidata.entity for full details. CC-0 public domain (Wikidata)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query (e.g. \"Tesla\", \"Barack Obama\", \"JavaScript\", \"Mount Everest\")" }, "language": { "type": "string", "description": "Language code for labels (e.g. \"en\", \"de\", \"fr\", \"ja\"). Default: en", "default": "en" }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Max results (1-20, default 10)", "default": 10 } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "knowledge.wikidata.entity", "description": "Get structured data for a Wikidata entity by ID (e.g. Q42 = Douglas Adams). Returns labels, descriptions, aliases, and up to 20 property statements. 300+ languages supported. CC-0 (Wikidata)", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "Wikidata entity ID (e.g. \"Q42\" for Douglas Adams, \"Q478214\" for Tesla Inc). Get IDs from wikidata.search" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "language.dictionary.define", "description": "Get word definition \u2014 phonetic pronunciation, part of speech, definitions with examples, synonyms, antonyms, audio URL. Supports 12 languages: en, es, fr, de, it, pt, ru, ar, hi, ja, ko, zh (Free Dictionary API)", "inputSchema": { "type": "object", "properties": { "word": { "type": "string", "description": "Word to define (e.g. \"algorithm\", \"serendipity\", \"ubuntu\")" }, "language": { "type": "string", "description": "Language code: en, es, fr, de, it, pt, ru, ar, hi, ja, ko, zh (default: en)", "default": "en" } }, "required": [ "word" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "language.dictionary.words", "description": "Find words by meaning, sound, rhyme, or spelling pattern. \"happy\" \u2192 pleased, blissful. \"algorithm\" rhymes \u2192 rhythm, logarithm. Great for writing, creative tasks, word games (Datamuse)", "inputSchema": { "type": "object", "properties": { "meaning": { "type": "string", "description": "Find words with this meaning (e.g. \"happy\" \u2192 pleased, blissful, content)" }, "sounds_like": { "type": "string", "description": "Find words that sound like this (e.g. \"elefant\" \u2192 elephant)" }, "rhymes_with": { "type": "string", "description": "Find words that rhyme with this (e.g. \"algorithm\" \u2192 rhythm, logarithm)" }, "starts_with": { "type": "string", "description": "Find words starting with these letters (e.g. \"algor\" \u2192 algorithm, algorithmic)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Max results (1-25, default 10)", "default": 10 } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "crypto.global.stats", "title": "Crypto Global Stats", "description": "Get global cryptocurrency market statistics", "inputSchema": { "type": "object", "properties": { "include_defi": { "type": "boolean", "description": "Include DeFi-specific global stats" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "stocks.company.profile", "title": "Company Profile", "description": "Company profile by ticker \u2014 name, exchange, industry, country, market cap, shares outstanding, IPO date, logo, website (Finnhub)", "inputSchema": { "type": "object", "properties": { "symbol": { "type": "string", "description": "Stock ticker symbol (e.g. \"AAPL\")", "minLength": 1, "maxLength": 10 } }, "required": [ "symbol" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "geo.address.reverse", "title": "Reverse Geocode (Geoapify)", "description": "Convert geographic coordinates (lat/lon) to a structured address \u2014 street, city, country, postal code (Geoapify/OSM)", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude of the point to reverse geocode.", "minimum": -90, "maximum": 90 }, "lon": { "type": "number", "description": "Longitude of the point to reverse geocode.", "minimum": -180, "maximum": 180 }, "lang": { "type": "string", "minLength": 2, "maxLength": 5, "description": "Result language code (e.g. \"en\", \"de\", \"ru\"). Default: English." } }, "required": [ "lat", "lon" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "developer.github.user", "title": "GitHub User Profile", "description": "Get a GitHub user profile \u2014 name, bio, public repos count, followers, company, location, join date. Works for users and organizations (GitHub API)", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "GitHub username (e.g. \"torvalds\", \"whiteknightonhorse\")" } }, "required": [ "username" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "noaa.weather.forecast", "title": "NOAA 7-Day Forecast", "description": "Get 7-day weather forecast for a US location by latitude/longitude. Returns day and night periods with temperature (\u00b0F), precipitation chance, wind speed/direction, and detailed forecast text. Powered by NOAA National Weather Service (api.weather.gov). US contiguous only.", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "Latitude in decimal degrees (US contiguous only: 24\u201350)", "minimum": 24, "maximum": 50 }, "longitude": { "type": "number", "description": "Longitude in decimal degrees (US contiguous only: \u2212125 to \u221266)", "minimum": -125, "maximum": -66 } }, "required": [ "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "noaa.weather.hourly", "title": "NOAA Hourly Forecast", "description": "Get hourly weather forecast (next 48 hours) for a US location by latitude/longitude. Returns temperature (\u00b0F), precipitation chance, wind speed/direction, and short conditions per hour. Powered by NOAA National Weather Service. US contiguous only.", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "Latitude in decimal degrees (US contiguous only: 24\u201350)", "minimum": 24, "maximum": 50 }, "longitude": { "type": "number", "description": "Longitude in decimal degrees (US contiguous only: \u2212125 to \u221266)", "minimum": -125, "maximum": -66 } }, "required": [ "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "noaa.weather.observation", "title": "NOAA Latest Observation", "description": "Get latest weather observation from the nearest ASOS/AWOS station to a US location. Returns current temperature (\u00b0C/\u00b0F), humidity, wind, pressure, visibility, dewpoint, heat index, wind chill. Powered by NOAA National Weather Service. US contiguous only.", "inputSchema": { "type": "object", "properties": { "latitude": { "type": "number", "description": "Latitude in decimal degrees (US contiguous only: 24\u201350)", "minimum": 24, "maximum": 50 }, "longitude": { "type": "number", "description": "Longitude in decimal degrees (US contiguous only: \u2212125 to \u221266)", "minimum": -125, "maximum": -66 } }, "required": [ "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "realestate.property.details", "title": "US Property Details", "description": "Detailed property information by property ID \u2014 beds, baths, sqft, year built, lot size, tax assessment, HOA, days on market, photos, last sale price/date. Use for_sale search first to get property_id (RapidAPI / Realtor.com data)", "inputSchema": { "type": "object", "properties": { "property_id": { "type": "string", "description": "Property ID from a for_sale search result (e.g. \"2734304997\")" } }, "required": [ "property_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "whoisjson.ssl.check", "title": "SSL Certificate Check", "description": "Validate SSL/TLS certificate for any domain. Returns issuer (org, CN), validity dates, subject CN, wildcard status, key size, and Subject Alternative Names (SAN) list. Useful for security audits, monitoring cert expiration, and verifying HTTPS configuration (WhoisJSON)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to check SSL certificate (e.g. google.com, apibase.pro)", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "whoisjson.dns.subdomains", "title": "Subdomain Discovery", "description": "Discover subdomains for any domain via DNS brute-force enumeration. Returns subdomain names, DNS record types (A/CNAME/MX), resolved IPs, and active/inactive status. Useful for security reconnaissance, asset inventory, and infrastructure mapping (WhoisJSON)", "inputSchema": { "type": "object", "properties": { "domain": { "type": "string", "description": "Domain name to discover subdomains (e.g. github.com, example.com)", "minLength": 1 } }, "required": [ "domain" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "npm.packages.downloads", "title": "npm Download Stats", "description": "Get download count for any npm package over a time period: last-day, last-week, last-month, last-year. Useful for measuring package popularity, adoption trends, and comparing alternatives (e.g. express: 92M/week).", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "npm package name (e.g. express, lodash, typescript)", "minLength": 1 }, "period": { "type": "string", "enum": [ "last-day", "last-week", "last-month", "last-year" ], "description": "Time period for download stats (default: last-week)" } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "npm.packages.info", "title": "npm Package Info", "description": "Get metadata for any npm package: version, description, license, dependencies, maintainers, repository URL, keywords, engines. 2.1M+ packages. Supports scoped packages (@scope/name). Returns latest version by default or a specific version.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "npm package name (e.g. express, react, @anthropic-ai/sdk)", "minLength": 1 }, "version": { "type": "string", "description": "Specific version to fetch (e.g. 5.2.1). Defaults to latest" } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "npm.packages.search", "title": "npm Package Search", "description": "Search 2.1M+ npm packages by keyword. Returns ranked results with quality, popularity, and maintenance scores, download counts, dependents, license, publisher. Find libraries for any task (e.g. \"mcp server\", \"react hooks\", \"typescript orm\").", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query (e.g. \"mcp server\", \"react hooks\", \"typescript orm\")", "minLength": 1 }, "size": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results to return (1-20, default 10)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "npm.packages.versions", "title": "npm Package Versions", "description": "List all published versions of an npm package with dist-tags (latest, next, beta), deprecation status, and total version count. Returns the 50 most recent versions. Useful for dependency auditing and upgrade planning.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "npm package name to list all versions (e.g. express, react)", "minLength": 1 } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "osv.security.batch", "title": "Batch Vulnerability Scan", "description": "Scan up to 100 packages at once for known vulnerabilities. Submit package+version+ecosystem triples (e.g. full requirements.txt or package.json dependencies) and get vulnerability matches for all in a single call. Ideal for full dependency tree security audits.", "inputSchema": { "type": "object", "properties": { "queries": { "type": "array", "items": { "type": "object", "properties": { "package": { "type": "string", "description": "Package name", "minLength": 1 }, "version": { "type": "string", "description": "Package version", "minLength": 1 }, "ecosystem": { "type": "string", "enum": [ "npm", "PyPI", "Go", "Maven", "crates.io", "NuGet", "Packagist", "RubyGems", "Pub", "Hex", "SwiftURL", "Linux", "Android", "OSS-Fuzz", "GIT" ], "description": "Package ecosystem (npm, PyPI, Go, Maven, crates.io, NuGet, Packagist, RubyGems, etc.)" } }, "required": [ "package", "version", "ecosystem" ] }, "description": "List of package+version+ecosystem to check (max 100)", "minItems": 1, "maxItems": 100 } }, "required": [ "queries" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "osv.security.get", "title": "Get Vulnerability Details", "description": "Retrieve full details for a vulnerability by OSV ID (GHSA-xxxx), CVE ID (CVE-2021-xxxxx), or ecosystem ID (PYSEC/RUSTSEC/GO). Returns summary, CVSS severity, affected packages with fix versions, and reference links.", "inputSchema": { "type": "object", "properties": { "vuln_id": { "type": "string", "description": "Vulnerability ID \u2014 OSV (e.g. GHSA-35jh-r3h4-6jhm), CVE (e.g. CVE-2021-23337), or PYSEC/GO/RUSTSEC ID", "minLength": 1 } }, "required": [ "vuln_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "osv.security.query", "title": "Query Package Vulnerabilities", "description": "Check known vulnerabilities for a specific package version in any ecosystem (npm, PyPI, Go, Maven, Rust, NuGet, 14+ more). Returns CVE/GHSA IDs, severity scores, and affected package counts. Powered by Google OSV.dev \u2014 aggregates GitHub Security Advisories, NVD, and ecosystem-native databases.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "Package name (e.g. lodash, requests, gin-gonic/gin)", "minLength": 1 }, "version": { "type": "string", "description": "Package version to check (e.g. 4.17.20, 2.25.0)", "minLength": 1 }, "ecosystem": { "type": "string", "enum": [ "npm", "PyPI", "Go", "Maven", "crates.io", "NuGet", "Packagist", "RubyGems", "Pub", "Hex", "SwiftURL", "Linux", "Android", "OSS-Fuzz", "GIT" ], "description": "Package ecosystem (npm, PyPI, Go, Maven, crates.io, NuGet, Packagist, RubyGems, etc.)" } }, "required": [ "package", "version", "ecosystem" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "census.data.demographics", "title": "US Demographics Data", "description": "Get demographic composition for any US geography \u2014 median age, race (white/Black/Asian), Hispanic/Latino population, and bachelor's degree attainment. Source: ACS 5-year estimates (US Census Bureau). Useful for market research, policy analysis, and neighborhood profiling.", "inputSchema": { "type": "object", "properties": { "state_fips": { "type": "string", "description": "US state FIPS code (e.g. 06 for California, 36 for New York, * for all states)", "minLength": 1, "maxLength": 2 }, "county_fips": { "type": "string", "description": "County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data." }, "year": { "type": "integer", "minimum": 2010, "maximum": 2023, "description": "Survey year (default 2022). ACS 5-year estimates available 2010-2022." } }, "required": [ "state_fips" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "census.data.economic", "title": "US Economic Data", "description": "Get economic indicators for any US geography \u2014 median household income, population in poverty, and unemployed count. Source: ACS 5-year estimates (US Census Bureau). Key data for market sizing, real estate analysis, and business location intelligence.", "inputSchema": { "type": "object", "properties": { "state_fips": { "type": "string", "description": "US state FIPS code (e.g. 06 for California, 36 for New York, * for all states)", "minLength": 1, "maxLength": 2 }, "county_fips": { "type": "string", "description": "County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data." }, "year": { "type": "integer", "minimum": 2010, "maximum": 2023, "description": "Survey year (default 2022). ACS 5-year estimates available 2010-2022." } }, "required": [ "state_fips" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "census.data.housing", "title": "US Housing Data", "description": "Get housing statistics for any US geography \u2014 total units, median home value, median rent, owner-occupied vs renter-occupied counts. Source: ACS 5-year estimates (US Census Bureau). Essential for real estate agents, property valuations, and housing market analysis.", "inputSchema": { "type": "object", "properties": { "state_fips": { "type": "string", "description": "US state FIPS code (e.g. 06 for California, 36 for New York, * for all states)", "minLength": 1, "maxLength": 2 }, "county_fips": { "type": "string", "description": "County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data." }, "year": { "type": "integer", "minimum": 2010, "maximum": 2023, "description": "Survey year (default 2022). ACS 5-year estimates available 2010-2022." } }, "required": [ "state_fips" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "census.data.population", "title": "US Population Data", "description": "Get population counts for any US geography by FIPS code \u2014 total, male, female. Covers all 50 states, 3,000+ counties, and sub-county areas. Source: American Community Survey 5-year estimates (US Census Bureau). Public domain, updated annually.", "inputSchema": { "type": "object", "properties": { "state_fips": { "type": "string", "description": "US state FIPS code (e.g. 06 for California, 36 for New York, * for all states)", "minLength": 1, "maxLength": 2 }, "county_fips": { "type": "string", "description": "County FIPS code within the state (e.g. 037 for Los Angeles, * for all counties). Omit for state-level data." }, "year": { "type": "integer", "minimum": 2010, "maximum": 2023, "description": "Survey year (default 2022). ACS 5-year estimates available 2010-2022." } }, "required": [ "state_fips" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "spending.federal.agency", "title": "Federal Agency Spending", "description": "Search federal awards by agency name (e.g. \"Defense\", \"NASA\", \"Health and Human Services\"). Returns top awards by amount for a fiscal year. Source: USAspending.gov \u2014 covers all federal agencies.", "inputSchema": { "type": "object", "properties": { "agency_name": { "type": "string", "description": "Federal agency name or keyword (e.g. \"Defense\", \"NASA\", \"Health and Human Services\")", "minLength": 1 }, "fiscal_year": { "type": "integer", "minimum": 2000, "maximum": 2026, "description": "Fiscal year (e.g. 2025). Default: current year." }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of top awards to return (1-25, default 10)" } }, "required": [ "agency_name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "spending.federal.awards", "title": "Federal Award Search", "description": "Search 60M+ US federal contract and grant awards by keyword, recipient, or NAICS code. Returns award amount, recipient, agency, dates, and description. Sorted by amount descending. Source: USAspending.gov (DATA Act mandate, US Gov open data).", "inputSchema": { "type": "object", "properties": { "keyword": { "type": "string", "description": "Search keyword for federal awards (e.g. \"artificial intelligence\", \"cybersecurity\", company name)", "minLength": 1 }, "fiscal_year": { "type": "integer", "minimum": 2000, "maximum": 2026, "description": "Fiscal year to filter (e.g. 2025). Default: current year." }, "award_type": { "type": "string", "enum": [ "contracts", "grants", "all" ], "description": "Filter by award type: contracts, grants, or all (default: all)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of results to return (1-25, default 10)" } }, "required": [ "keyword" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "spending.federal.geography", "title": "Federal Spending by State", "description": "Get total US federal spending by state for contracts, grants, or all awards in a fiscal year. Returns all 50+ states sorted by spending amount. Useful for regional economic analysis and policy research. Source: USAspending.gov.", "inputSchema": { "type": "object", "properties": { "fiscal_year": { "type": "integer", "minimum": 2017, "maximum": 2026, "description": "Fiscal year (e.g. 2025). Default: current year." }, "award_type": { "type": "string", "enum": [ "contracts", "grants", "all" ], "description": "Filter by award type: contracts, grants, or all (default: all)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "sam.gov.entity_detail", "title": "SAM.gov Entity Detail", "description": "Get full SAM.gov registration details for a federal contractor by UEI (Unique Entity Identifier). Returns legal name, CAGE code, addresses, NAICS/PSC codes, business certifications, entity structure, organization type, and registration dates. Source: SAM.gov (GSA).", "inputSchema": { "type": "object", "properties": { "uei": { "type": "string", "description": "Unique Entity Identifier (UEI) \u2014 12-character SAM.gov ID (e.g. KM99JJBNQ9M5 for Lockheed Martin)", "minLength": 1 } }, "required": [ "uei" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "sam.gov.entity_search", "title": "SAM.gov Entity Search", "description": "Search 700K+ registered US federal contractors and grantees by company name, state, or NAICS code. Returns UEI (Unique Entity Identifier), CAGE code, registration status, business types (Small Business, 8(a), HUBZone, WOSB, Veteran-Owned), and NAICS codes. Source: SAM.gov (GSA).", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Company or organization name to search (e.g. \"Lockheed\", \"Google\", \"Deloitte\"). Supports partial match.", "minLength": 1 }, "state": { "type": "string", "maxLength": 2, "description": "US state code to filter (e.g. VA, CA, TX)" }, "naics_code": { "type": "string", "description": "NAICS industry code to filter (e.g. 541512 for Computer Systems Design)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of results (1-25, default 10)" } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "fema.disaster.assistance", "title": "FEMA Housing Assistance", "description": "Query federal disaster housing assistance data by state and disaster number. Returns registration counts, average damage, total inspected, approved amounts by county. Useful for disaster recovery analysis and aid distribution research. Source: OpenFEMA.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "US state code (e.g. TX, FL, CA)", "minLength": 2, "maxLength": 2 }, "disaster_number": { "type": "integer", "description": "FEMA disaster number to filter (e.g. 4673)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "state" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "fema.disaster.declarations", "title": "FEMA Disaster Declarations", "description": "Search US federal disaster declarations from 1953 to present. Filter by state, incident type (Fire, Flood, Hurricane, Tornado, Earthquake), and year. Returns disaster number, title, dates, designated programs (IA, PA, HM). Source: OpenFEMA (US Gov open data).", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "US state code (e.g. CA, TX, FL). Omit for all states." }, "incident_type": { "type": "string", "enum": [ "Fire", "Flood", "Hurricane", "Tornado", "Earthquake", "Severe Storm(s)", "Snow", "Drought", "Typhoon", "Biological", "Other" ], "description": "Disaster type to filter (e.g. Fire, Flood, Hurricane)" }, "year": { "type": "integer", "minimum": 1953, "maximum": 2026, "description": "Filter by declaration year (1953-2026)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "fema.disaster.flood_claims", "title": "NFIP Flood Insurance Claims", "description": "Retrieve National Flood Insurance Program (NFIP) claims by state and year. Returns flood zone, building/contents payments, insurance coverage amounts, cause of damage. Essential for flood risk assessment and insurance analysis. Source: OpenFEMA.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "US state code (e.g. FL, TX, LA)", "minLength": 2, "maxLength": 2 }, "year": { "type": "integer", "minimum": 1970, "maximum": 2026, "description": "Year of loss to filter (e.g. 2024)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "state" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "pypi.packages.info", "title": "PyPI Package Info", "description": "Get metadata for any Python package from PyPI: version, summary, license, author, dependencies, classifiers, Python version requirements. 550K+ packages. Supports specific version lookup. Complements npm (UC-344) for polyglot dependency intelligence.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "Python package name (e.g. requests, flask, numpy, anthropic)", "minLength": 1 }, "version": { "type": "string", "description": "Specific version (e.g. 2.31.0). Defaults to latest release." } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "pypi.packages.releases", "title": "PyPI Package Versions", "description": "List all published versions of a Python package with upload dates, yanked status, and distribution file types (sdist/wheel). Returns the 50 most recent versions. Useful for dependency auditing, version pinning, and upgrade planning.", "inputSchema": { "type": "object", "properties": { "package": { "type": "string", "description": "Python package name to list all versions (e.g. django, pandas, scipy)", "minLength": 1 } }, "required": [ "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "gbif.biodiversity.occurrence_count", "title": "GBIF Occurrence Count", "description": "Get total occurrence count for a species, optionally filtered by country. Useful for range size estimation, data density assessment, and conservation status analysis. Source: GBIF.", "inputSchema": { "type": "object", "properties": { "taxon_key": { "type": "integer", "description": "GBIF taxon key to count occurrences for" }, "country": { "type": "string", "minLength": 2, "maxLength": 2, "description": "ISO country code to filter count (e.g. US, BR)" } }, "required": [ "taxon_key" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "gbif.biodiversity.occurrences", "title": "GBIF Species Occurrences", "description": "Search 2.5B+ species occurrence records by taxon, country, and year. Returns observation coordinates, date, collector institution, basis of record (specimen/observation). Filter by ISO country code. Source: GBIF (2000+ institutions, 100+ countries).", "inputSchema": { "type": "object", "properties": { "taxon_key": { "type": "integer", "description": "GBIF taxon key for the species to search occurrences" }, "country": { "type": "string", "minLength": 2, "maxLength": 2, "description": "ISO 3166-1 alpha-2 country code (e.g. US, GB, BR, AU)" }, "year": { "type": "integer", "minimum": 1700, "maximum": 2026, "description": "Filter by observation year (e.g. 2024)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "taxon_key" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "gbif.biodiversity.species_details", "title": "GBIF Species Details", "description": "Get full taxonomic profile for a species by GBIF taxon key. Returns classification hierarchy, vernacular (common) names, synonyms, number of descendants, and accepted name. Source: GBIF backbone taxonomy.", "inputSchema": { "type": "object", "properties": { "taxon_key": { "type": "integer", "description": "GBIF taxon key (numeric ID from species search results)" } }, "required": [ "taxon_key" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "gbif.biodiversity.species_search", "title": "GBIF Species Search", "description": "Search 9M+ species in the GBIF backbone taxonomy by common or scientific name. Returns taxon key, scientific name, kingdom/phylum/class/order/family/genus, and taxonomic status. Filter by rank (SPECIES, GENUS, FAMILY). Source: Global Biodiversity Information Facility (CC0).", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Species name to search \u2014 common name (e.g. \"polar bear\") or scientific name (e.g. \"Ursus maritimus\")", "minLength": 1 }, "rank": { "type": "string", "enum": [ "KINGDOM", "PHYLUM", "CLASS", "ORDER", "FAMILY", "GENUS", "SPECIES" ], "description": "Taxonomic rank filter (default: SPECIES). Use SPECIES to avoid virus/subspecies matches." }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results (1-20, default 5)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "congress.legislation.bill_details", "title": "US Bill Details", "description": "Get full details for a specific US bill by Congress number, type (hr/s), and bill number. Returns title, all sponsors, co-sponsor count, action history, committee referrals, policy subjects. Source: Congress.gov.", "inputSchema": { "type": "object", "properties": { "congress": { "type": "integer", "description": "Congress number (e.g. 119 for 2025-2026, 118 for 2023-2024)", "minimum": 93, "maximum": 119 }, "type": { "type": "string", "enum": [ "hr", "s", "hjres", "sjres", "hconres", "sconres", "hres", "sres" ], "description": "Bill type: hr (House bill), s (Senate bill), hjres, sjres, etc." }, "number": { "type": "integer", "description": "Bill number (e.g. 1 for HR 1)", "minimum": 1 } }, "required": [ "congress", "type", "number" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "congress.legislation.bills", "title": "US Congressional Bills", "description": "Search US federal bills and resolutions from 1973 to present. Filter by Congress number (93-119), bill type (hr/s/hjres/sjres). Returns title, sponsor, party, latest action, policy area. Source: Congress.gov (Library of Congress).", "inputSchema": { "type": "object", "properties": { "congress": { "type": "integer", "minimum": 93, "maximum": 119, "description": "Congress number (93=1973 to 119=2025-2026). Default: current (119)." }, "type": { "type": "string", "enum": [ "hr", "s", "hjres", "sjres", "hconres", "sconres", "hres", "sres" ], "description": "Bill type: hr (House), s (Senate), hjres, sjres, hconres, sconres, hres, sres" }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of results (1-25, default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "congress.legislation.members", "title": "US Congressional Members", "description": "Search current and historical members of the US Congress. Filter by state, chamber (House/Senate), and Congress number. Returns name, party, state, district, bioguide ID. Source: Congress.gov.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "US state code (e.g. CA, TX, NY)" }, "chamber": { "type": "string", "enum": [ "house", "senate" ], "description": "Chamber: house or senate" }, "congress": { "type": "integer", "minimum": 93, "maximum": 119, "description": "Congress number. Default: current (119)." }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of results (1-25, default 10)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "depsdev.insights.advisories", "title": "Security Advisories (deps.dev)", "description": "List security advisories (from OSV) affecting a specific package version. Cross-ecosystem: npm, PyPI, Go, Maven, Cargo, NuGet. Returns advisory IDs with links to OSV.dev for full details. Complements osv.query for version-specific lookups.", "inputSchema": { "type": "object", "properties": { "system": { "type": "string", "enum": [ "npm", "pypi", "go", "maven", "cargo", "nuget" ], "description": "Package ecosystem: npm, pypi, go, maven, cargo, or nuget" }, "package": { "type": "string", "description": "Package name to check for security advisories", "minLength": 1 }, "version": { "type": "string", "description": "Package version to check (e.g. 4.17.20)", "minLength": 1 } }, "required": [ "system", "package", "version" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "depsdev.insights.dependencies", "title": "Dependency Tree (deps.dev)", "description": "Resolve the full transitive dependency tree for a package version. Returns all direct and indirect dependencies with versions and relation type. Reveals hidden supply chain depth (e.g. express@5.2.1 has 67 transitive deps). Google deps.dev.", "inputSchema": { "type": "object", "properties": { "system": { "type": "string", "enum": [ "npm", "pypi", "go", "maven", "cargo", "nuget" ], "description": "Package ecosystem: npm, pypi, go, maven, cargo, or nuget" }, "package": { "type": "string", "description": "Package name (e.g. lodash, flask, github.com/gin-gonic/gin)", "minLength": 1 }, "version": { "type": "string", "description": "Package version to resolve dependencies for (e.g. 4.17.21, 3.0.0)", "minLength": 1 } }, "required": [ "system", "package", "version" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "depsdev.insights.package", "title": "Package Info (deps.dev)", "description": "Get package metadata from Google deps.dev \u2014 all versions, default version, ecosystem. Covers npm, PyPI, Go, Maven, Cargo, NuGet (50M+ package versions). Complements npm/PyPI registries with cross-ecosystem unified view.", "inputSchema": { "type": "object", "properties": { "system": { "type": "string", "enum": [ "npm", "pypi", "go", "maven", "cargo", "nuget" ], "description": "Package ecosystem: npm, pypi, go, maven, cargo, or nuget" }, "package": { "type": "string", "description": "Package name (e.g. express, requests, gin-gonic/gin, log4j-core)", "minLength": 1 } }, "required": [ "system", "package" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "epa.environment.toxic_releases", "title": "EPA Toxic Release Inventory", "description": "Search EPA Toxic Release Inventory (TRI) facilities by US state or ZIP code. Returns facility name, address, county, industry sector, and closed status. 600K+ regulated facilities. Source: EPA Envirofacts (US Gov open data).", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "US state code (e.g. CA, TX, NY, FL)", "minLength": 2, "maxLength": 2 }, "zip_code": { "type": "string", "description": "ZIP code to filter (e.g. 90001). Overrides state filter if provided." }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "state" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "epa.environment.water_systems", "title": "EPA Public Water Systems", "description": "Search public water systems by US state. Returns system name, PWSID, activity status, primacy agency, EPA region, population served, and service connections. Source: EPA Safe Drinking Water Act data.", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "description": "US state code (e.g. FL, CA, TX)", "minLength": 2, "maxLength": 2 }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 10)" } }, "required": [ "state" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ncei.climate.daily_data", "title": "NCEI Daily Climate Data", "description": "Retrieve historical daily weather observations from NOAA NCEI \u2014 max/min temperature, precipitation, snowfall, wind speed. 260+ years of records from global stations. Values in tenths of \u00b0C (temp) and tenths of mm (precip). Source: GHCND dataset.", "inputSchema": { "type": "object", "properties": { "station_id": { "type": "string", "description": "NCEI station ID (e.g. GHCND:USW00094728 for Central Park, NY). Get from ncei.stations tool.", "minLength": 1 }, "start_date": { "type": "string", "description": "Start date in YYYY-MM-DD format (e.g. 2025-01-01)" }, "end_date": { "type": "string", "description": "End date in YYYY-MM-DD format (e.g. 2025-01-31). Max 1 year range." }, "datatypes": { "type": "string", "description": "Comma-separated data types: TMAX (max temp), TMIN (min temp), PRCP (precipitation), SNOW, AWND (avg wind). Default: all." } }, "required": [ "station_id", "start_date", "end_date" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "ncei.climate.stations", "title": "NCEI Weather Stations", "description": "Search 100K+ global weather stations from NOAA NCEI by location (state FIPS, ZIP, country). Returns station ID, name, coordinates, elevation, and data coverage dates (some from 1700s). Use station IDs with ncei.daily_data for historical climate records.", "inputSchema": { "type": "object", "properties": { "location_id": { "type": "string", "description": "Location ID: FIPS:06 (California), FIPS:36 (New York), ZIP:10001, CITY:US360019, or CNTRY:US", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 25, "description": "Number of stations to return (1-25, default 10)" } }, "required": [ "location_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "climate.indicators.arctic_ice", "title": "Arctic Sea Ice Extent", "description": "Arctic sea ice extent from NSIDC \u2014 monthly measurements in million km\u00b2 since 1979. Tracks long-term decline in Arctic ice coverage. Returns last 10 years by default. Source: National Snow and Ice Data Center.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "climate.indicators.co2", "title": "Atmospheric CO2 (Keeling Curve)", "description": "Atmospheric CO2 concentration from NOAA Mauna Loa Observatory \u2014 the Keeling Curve. Monthly readings in ppm (parts per million) since 1958. Returns last 10 years by default. Source: NOAA ESRL.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "climate.indicators.methane", "title": "Atmospheric Methane", "description": "Atmospheric methane concentration from NOAA ESRL \u2014 monthly readings in ppb (parts per billion) since 1983. Methane is the second most important greenhouse gas after CO2. Returns last 10 years by default.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "climate.indicators.nitrous_oxide", "title": "Atmospheric Nitrous Oxide", "description": "Atmospheric nitrous oxide concentration from NOAA ESRL \u2014 monthly readings in ppb since 2001. N2O is a potent greenhouse gas with 273x the warming potential of CO2. Returns last 10 years by default.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "climate.indicators.temperature", "title": "Global Temperature Anomaly", "description": "Global surface temperature anomaly from NASA GISS \u2014 monthly readings since 1880. Values in \u00b0C vs 1951-1980 baseline. Returns last 10 years by default (adjustable 1-50). Source: NASA Goddard Institute for Space Studies.", "inputSchema": { "type": "object", "properties": { "years": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of years of data to return (1-50, default 10). Data is monthly." } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "chart.visualization.create", "title": "Create Chart Image", "description": "\u26a1 ACTION: Generate a chart image (PNG) from data \u2014 bar, line, pie, doughnut, radar, scatter. Returns a permanent image URL. Combine with data tools (climate.co2, census.population, finance.exchange_rates) to visualize any dataset. Powered by QuickChart (Chart.js).", "inputSchema": { "type": "object", "properties": { "type": { "type": "string", "enum": [ "bar", "line", "pie", "doughnut", "radar", "scatter", "horizontalBar" ], "description": "Chart type: bar, line, pie, doughnut, radar, scatter, horizontalBar" }, "labels": { "type": "array", "items": { "type": "string" }, "description": "X-axis labels (e.g. [\"Q1\", \"Q2\", \"Q3\", \"Q4\"])" }, "datasets": { "type": "array", "items": { "type": "object", "properties": { "label": { "type": "string", "description": "Dataset label (e.g. \"Revenue\", \"Temperature\")" }, "data": { "type": "array", "items": { "type": "number" }, "description": "Array of numeric values" } }, "required": [ "label", "data" ] }, "description": "One or more datasets to plot", "minItems": 1 }, "title": { "type": "string", "description": "Chart title displayed at top" }, "width": { "type": "integer", "minimum": 100, "maximum": 1000, "description": "Image width in pixels (100-1000, default 500)" }, "height": { "type": "integer", "minimum": 100, "maximum": 1000, "description": "Image height in pixels (100-1000, default 300)" } }, "required": [ "type", "labels", "datasets" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "figi.finance.filter", "title": "Filter Financial Instruments", "description": "Filter financial instruments by exchange code, market sector (Equity/Corp/Govt/Index/Curncy/Comdty), or security type (Common Stock/ETP/REIT/ADR). Browse instrument universe by structured criteria. Bloomberg OpenFIGI.", "inputSchema": { "type": "object", "properties": { "exchange_code": { "type": "string", "description": "Exchange code (e.g. US, LN, HK, JP)" }, "market_sector": { "type": "string", "description": "Market sector (e.g. Equity, Corp, Govt, Index, Curncy, Comdty)" }, "security_type": { "type": "string", "description": "Security type (e.g. \"Common Stock\", \"ETP\", \"REIT\", \"ADR\")" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "figi.finance.map", "title": "Map Financial Identifier to FIGI", "description": "Resolve financial instrument identifiers \u2014 ISIN, CUSIP, SEDOL, or ticker symbol to Bloomberg FIGI (ISO 18774). Returns FIGI, composite FIGI, security name, type, and exchange. 300M+ instruments across 45K+ exchanges. Use ID_ISIN, ID_CUSIP, ID_SEDOL, or TICKER as id_type.", "inputSchema": { "type": "object", "properties": { "id_type": { "type": "string", "enum": [ "ID_ISIN", "ID_CUSIP", "ID_SEDOL", "ID_BB_GLOBAL", "TICKER", "ID_WERTPAPIER", "ID_COMMON" ], "description": "Identifier type: ID_ISIN, ID_CUSIP, ID_SEDOL, TICKER, ID_BB_GLOBAL" }, "id_value": { "type": "string", "description": "Identifier value (e.g. US0378331005 for ISIN, AAPL for ticker, BBG000B9XRY4 for FIGI)", "minLength": 1 }, "exchange_code": { "type": "string", "description": "Exchange code to narrow results (e.g. US, LN, JP). Optional." } }, "required": [ "id_type", "id_value" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "figi.finance.search", "title": "Search Financial Instruments", "description": "Search 300M+ financial instruments by company name or ticker keyword. Filter by exchange and security type. Returns Bloomberg FIGI, ticker, name, market sector. Covers equities, ETPs, bonds, derivatives globally.", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query \u2014 company name or ticker (e.g. \"Tesla\", \"Apple Inc\", \"MSFT\")", "minLength": 1 }, "exchange_code": { "type": "string", "description": "Filter by exchange code (e.g. US, LN, JP)" }, "security_type": { "type": "string", "description": "Filter by security type (e.g. \"Common Stock\", \"ETP\", \"REIT\")" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "finance.edgar.xbrl_concept", "title": "SEC Company Financial History", "description": "Complete history of any XBRL financial concept (Revenues, NetIncomeLoss, Assets, EPS) for a company across all SEC filings. Returns up to 20 most recent values with period dates, form type, fiscal year. Free alternative to Bloomberg for historical financials.", "inputSchema": { "type": "object", "properties": { "cik": { "type": "string", "description": "SEC CIK number (e.g. \"320193\" for Apple, \"789019\" for Microsoft)", "minLength": 1 }, "tag": { "type": "string", "description": "XBRL concept tag (e.g. Revenues, NetIncomeLoss, Assets, EarningsPerShareBasic)", "minLength": 1 }, "taxonomy": { "type": "string", "description": "XBRL taxonomy (default: us-gaap). Other: ifrs-full, dei, srt" } }, "required": [ "cik", "tag" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "finance.edgar.xbrl_frames", "title": "SEC Cross-Company Financial Comparison", "description": "Compare a financial metric across ALL SEC-reporting companies for a period. Query Revenues for CY2023 \u2192 2,649 companies with values. Top: Walmart $648B, UnitedHealth $371B. Free alternative to Bloomberg/FactSet. Period format: CY2023 (annual), CY2023Q4I (quarterly).", "inputSchema": { "type": "object", "properties": { "tag": { "type": "string", "description": "XBRL concept tag (e.g. Revenues, NetIncomeLoss, Assets, TotalDebt)", "minLength": 1 }, "period": { "type": "string", "description": "Reporting period: CY2023 (annual), CY2023Q4I (quarterly instant), CY2023Q3 (quarterly duration)", "minLength": 1 }, "unit": { "type": "string", "description": "Unit of measure (default: USD). Other: USD/shares for EPS, shares for share counts" }, "taxonomy": { "type": "string", "description": "XBRL taxonomy (default: us-gaap)" } }, "required": [ "tag", "period" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "usno.astronomy.moon_phases", "title": "Moon Phases", "description": "Get all moon phase dates for a year \u2014 New Moon, First Quarter, Full Moon, Last Quarter with exact UTC timestamps. ~50 phases per year. Source: US Naval Observatory (canonical astronomical authority, US Gov public domain).", "inputSchema": { "type": "object", "properties": { "year": { "type": "integer", "minimum": 1700, "maximum": 2100, "description": "Year for moon phases (default: current year, e.g. 2026)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "usno.astronomy.seasons", "title": "Equinoxes & Solstices", "description": "Get exact dates and UTC times for vernal equinox, summer solstice, autumnal equinox, and winter solstice for any year. Also includes Earth perihelion and aphelion dates. Source: US Naval Observatory.", "inputSchema": { "type": "object", "properties": { "year": { "type": "integer", "minimum": 1700, "maximum": 2100, "description": "Year for equinoxes and solstices (default: current year)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "usno.astronomy.sun_moon", "title": "Sun & Moon Rise/Set Times", "description": "Get sunrise, sunset, moonrise, moonset, and transit times for any location and date. Includes civil/nautical/astronomical twilight. Used for photography golden hour, agriculture planning, outdoor events. Source: USNO.", "inputSchema": { "type": "object", "properties": { "date": { "type": "string", "description": "Date in YYYY-MM-DD format (e.g. 2026-04-07)" }, "latitude": { "type": "number", "description": "Latitude in decimal degrees (e.g. 40.7128 for New York)", "minimum": -90, "maximum": 90 }, "longitude": { "type": "number", "description": "Longitude in decimal degrees (e.g. -74.0060 for New York)", "minimum": -180, "maximum": 180 } }, "required": [ "date", "latitude", "longitude" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "wger.fitness.exercise_details", "title": "Exercise Details", "description": "Get full exercise details by ID \u2014 description, primary and secondary muscles worked, required equipment (barbell/dumbbell/bodyweight/machine), and category. Use with exercise_search to build workout plans.", "inputSchema": { "type": "object", "properties": { "id": { "type": "integer", "description": "Exercise base ID from search results (e.g. 615 for Squats)" } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "wger.fitness.exercise_search", "title": "Exercise Search", "description": "Search 896 exercises by name \u2014 bench press, squat, deadlift, curl, etc. Returns exercise name, category (Chest/Back/Legs/Arms/Abs/Shoulders/Cardio), and ID for details lookup. Open-source fitness database (Wger, CC-BY-SA).", "inputSchema": { "type": "object", "properties": { "term": { "type": "string", "description": "Exercise name to search (e.g. \"bench press\", \"squat\", \"deadlift\", \"bicep curl\")", "minLength": 1 } }, "required": [ "term" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "wger.fitness.ingredients", "title": "Food Ingredient Nutrition", "description": "Search 1.28M food ingredients by name \u2014 chicken breast, rice, banana, oats. Returns calories (kcal), protein, carbs, fat, fiber, sugar, sodium per 100g. Complements USDA FDC with broader international coverage.", "inputSchema": { "type": "object", "properties": { "name": { "type": "string", "description": "Food ingredient name (e.g. \"chicken breast\", \"rice\", \"banana\", \"oats\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results (1-20, default 10)" } }, "required": [ "name" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "email.verification.check", "title": "Verify Email Address", "description": "Verify an email address \u2014 SMTP deliverability check, DNS/MX validation, disposable email detection, catch-all server detection, free provider flag, role account flag (info@, admin@). Returns comprehensive verification result. Powered by WhoisXML API.", "inputSchema": { "type": "object", "properties": { "email": { "type": "string", "description": "Email address to verify (e.g. user@example.com, test@gmail.com)", "minLength": 3 } }, "required": [ "email" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "solar.system.bodies", "title": "Solar System Bodies", "description": "List solar system bodies \u2014 planets, moons, asteroids, comets, dwarf planets. Returns name, body type, gravity, radius, and moon count. 1,400+ bodies. Filter by type. Source: Solar System OpenData (MIT license).", "inputSchema": { "type": "object", "properties": { "body_type": { "type": "string", "enum": [ "planet", "moon", "asteroid", "comet", "dwarf_planet", "all" ], "description": "Filter by body type: planet, moon, asteroid, comet, dwarf_planet, or all (default: all)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "solar.system.body_details", "title": "Solar System Body Details", "description": "Get comprehensive data for a solar system body \u2014 mass, radius, density, gravity, escape velocity, temperature, axial tilt, orbital period, semi-major axis, eccentricity, inclination, discoverer, and list of moons. Source: Solar System OpenData.", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "Body ID from search results (e.g. \"mars\", \"jupiter\", \"moon\", \"europa\", \"ceres\")", "minLength": 1 } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "iss.space.position", "title": "ISS Current Position", "description": "Get the real-time position of the International Space Station \u2014 latitude, longitude, altitude (km), velocity (km/h), and daylight/eclipse visibility. ISS orbits at 28,000 km/h, completes one orbit every 90 minutes. Updates every ~60 seconds.", "inputSchema": { "type": "object", "properties": { "units": { "type": "string", "enum": [ "kilometers", "miles" ], "description": "Distance units: kilometers (default) or miles" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "iss.space.tle", "title": "ISS Orbital Elements (TLE)", "description": "Get the Two-Line Element set (TLE) for the International Space Station \u2014 NORAD catalog #25544. Contains orbital parameters for trajectory prediction and satellite tracking calculations.", "inputSchema": { "type": "object", "properties": { "format": { "type": "string", "enum": [ "json", "text" ], "description": "Response format: json (default) or text (raw TLE two-line element)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "hf.hub.datasets", "title": "Search ML Datasets", "description": "Search 200K+ datasets on HuggingFace Hub by name or keyword. Returns dataset ID, downloads, likes, tags. Covers NLP, vision, audio, tabular datasets. Sorted by downloads.", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Search query \u2014 dataset name or keyword (e.g. \"wikipedia\", \"imagenet\", \"squad\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results (1-20, default 10)" } }, "required": [ "search" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "hf.hub.model_details", "title": "ML Model Details", "description": "Get full metadata for a HuggingFace model \u2014 downloads, likes, tags, library, author, pipeline task, model card data. Use model_id from hf.models search (e.g. \"meta-llama/Llama-3.3-70B-Instruct\").", "inputSchema": { "type": "object", "properties": { "model_id": { "type": "string", "description": "Full model ID (e.g. \"meta-llama/Llama-3.3-70B-Instruct\", \"stabilityai/stable-diffusion-xl-base-1.0\")", "minLength": 1 } }, "required": [ "model_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "hf.hub.models", "title": "Search ML Models", "description": "Search 1M+ ML models on HuggingFace Hub by name, task (text-generation, image-classification, translation), or library (transformers, diffusers). Returns model ID, downloads, likes, pipeline tag. Sorted by downloads.", "inputSchema": { "type": "object", "properties": { "search": { "type": "string", "description": "Search query \u2014 model name or keyword (e.g. \"llama\", \"stable-diffusion\", \"whisper\")", "minLength": 1 }, "task": { "type": "string", "description": "Filter by ML task: text-generation, image-classification, translation, text-to-image, automatic-speech-recognition, etc." }, "library": { "type": "string", "description": "Filter by framework: transformers, diffusers, sentence-transformers, gguf, etc." }, "limit": { "type": "integer", "minimum": 1, "maximum": 20, "description": "Number of results (1-20, default 10)" } }, "required": [ "search" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "crypto.global.stats", "title": "Crypto Global Stats", "description": "Get global cryptocurrency market statistics", "inputSchema": { "type": "object", "properties": { "include_defi": { "type": "boolean", "description": "Include DeFi-specific global stats" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "stocks.company.profile", "title": "Company Profile", "description": "Company profile by ticker \u2014 name, exchange, industry, country, market cap, shares outstanding, IPO date, logo, website (Finnhub)", "inputSchema": { "type": "object", "properties": { "symbol": { "type": "string", "description": "Stock ticker symbol (e.g. \"AAPL\")", "minLength": 1, "maxLength": 10 } }, "required": [ "symbol" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "geo.address.reverse", "title": "Reverse Geocode (Geoapify)", "description": "Convert geographic coordinates (lat/lon) to a structured address \u2014 street, city, country, postal code (Geoapify/OSM)", "inputSchema": { "type": "object", "properties": { "lat": { "type": "number", "description": "Latitude of the point to reverse geocode.", "minimum": -90, "maximum": 90 }, "lon": { "type": "number", "description": "Longitude of the point to reverse geocode.", "minimum": -180, "maximum": 180 }, "lang": { "type": "string", "minLength": 2, "maxLength": 5, "description": "Result language code (e.g. \"en\", \"de\", \"ru\"). Default: English." } }, "required": [ "lat", "lon" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "developer.github.user", "title": "GitHub User Profile", "description": "Get a GitHub user profile \u2014 name, bio, public repos count, followers, company, location, join date. Works for users and organizations (GitHub API)", "inputSchema": { "type": "object", "properties": { "username": { "type": "string", "description": "GitHub username (e.g. \"torvalds\", \"whiteknightonhorse\")" } }, "required": [ "username" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "realestate.property.details", "title": "US Property Details", "description": "Detailed property information by property ID \u2014 beds, baths, sqft, year built, lot size, tax assessment, HOA, days on market, photos, last sale price/date. Use for_sale search first to get property_id (RapidAPI / Realtor.com data)", "inputSchema": { "type": "object", "properties": { "property_id": { "type": "string", "description": "Property ID from a for_sale search result (e.g. \"2734304997\")" } }, "required": [ "property_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "water.usgs.realtime", "title": "Real-Time Water Data", "description": "Get real-time streamflow (ft^3/s), gage height (ft), water temperature, and conductance for a USGS monitoring site. Updated every 15 minutes. Covers rivers, streams, lakes, reservoirs across the US. Use water.sites to find site numbers (USGS)", "inputSchema": { "type": "object", "properties": { "site_no": { "type": "string", "description": "USGS site number (e.g. \"09380000\"). Use water.sites to find site numbers first.", "minLength": 1 }, "parameter_cd": { "type": "string", "description": "Parameter code(s), comma-separated. Common: 00060=streamflow, 00065=gage height, 00010=temperature. Default: all available." }, "period": { "type": "string", "description": "ISO 8601 duration for data window (e.g. \"PT2H\" for 2 hours, \"P7D\" for 7 days). Default: PT2H." } }, "required": [ "site_no" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "water.usgs.sites", "title": "Search Water Monitoring Sites", "description": "Search 1.5M+ USGS water monitoring sites by US state, county FIPS, bounding box, or site number. Returns site ID, station name, coordinates, altitude, HUC watershed code. Use site numbers with water.realtime for live data (USGS)", "inputSchema": { "type": "object", "properties": { "state": { "type": "string", "minLength": 2, "maxLength": 2, "description": "US state FIPS code, 2 chars (e.g. \"CA\", \"NY\", \"CO\")" }, "county": { "type": "string", "description": "County FIPS code, 5 digits (e.g. \"06037\" for Los Angeles County)" }, "bbox": { "type": "string", "description": "Bounding box: west,south,east,north in decimal degrees (e.g. \"-105.5,39.5,-104.5,40.5\")" }, "site_no": { "type": "string", "description": "USGS site number (e.g. \"09380000\" for Colorado River at Lees Ferry)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "worldbank.dev.indicators", "title": "Search Development Indicators", "description": "Search 16,000+ World Bank development indicators by keyword or topic \u2014 GDP, population, poverty, education, health, environment, trade. Returns indicator ID, name, source, description, topics. Use indicator IDs with finance.country_data for time-series data (World Bank, CC BY 4.0)", "inputSchema": { "type": "object", "properties": { "keyword": { "type": "string", "description": "Search keyword for indicators (e.g. \"gdp\", \"population\", \"poverty\", \"education\", \"co2 emissions\")" }, "topic": { "type": "string", "description": "Topic ID filter (1=Agriculture, 3=Economy, 4=Education, 6=Environment, 8=Health, 11=Poverty, 14=Science, 19=Climate Change)" }, "source": { "type": "string", "description": "Source ID filter (2=World Development Indicators, 11=Africa, 57=Gender)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Results per page (1-50, default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "cdc.health.datasets", "title": "Search CDC Health Datasets", "description": "Search 1,400+ CDC public health datasets \u2014 COVID-19, chronic disease, vaccination, mortality, birth/death statistics, environmental health. Returns dataset ID, name, description, category. Use dataset IDs with cdc.query to fetch data (US Gov)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search keyword (e.g. \"covid deaths\", \"vaccination rates\", \"chronic disease\", \"mortality\")" }, "category": { "type": "string", "description": "Dataset category filter (e.g. \"NCHS\", \"COVID-19\", \"Chronic Disease Indicators\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "cdc.health.query", "title": "Query CDC Dataset", "description": "Query a specific CDC dataset using SoQL filters \u2014 filter by state, year, age group, condition. Returns structured rows with column names. Supports WHERE, SELECT, ORDER, GROUP BY. Use cdc.datasets to find dataset IDs first (US Gov, Socrata SODA API)", "inputSchema": { "type": "object", "properties": { "dataset_id": { "type": "string", "description": "CDC dataset ID in xxxx-xxxx format (e.g. \"9bhg-hcku\" for COVID deaths). Use cdc.datasets to find IDs." }, "where": { "type": "string", "description": "SoQL WHERE clause filter (e.g. \"state='CA'\", \"year > 2020\", \"age_group='65+'\")" }, "select": { "type": "string", "description": "Columns to return, comma-separated (e.g. \"state, year, deaths\"). Default: all columns." }, "order": { "type": "string", "description": "Sort order (e.g. \"year DESC\", \"deaths DESC\"). Default: dataset default order." }, "group": { "type": "string", "description": "Group by columns for aggregation (e.g. \"state\" with select \"state, SUM(deaths)\")" }, "limit": { "type": "integer", "minimum": 1, "maximum": 1000, "description": "Max rows to return (1-1000, default 100)" } }, "required": [ "dataset_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "dblp.cs.author", "title": "Search CS Authors", "description": "Search 3M+ computer science authors on DBLP. Returns author name, DBLP PID, profile URL, aliases, affiliations. Use for finding researchers, checking publication records, or discovering collaborators (DBLP, CC0)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Author name to search (e.g. \"Geoffrey Hinton\", \"Yann LeCun\", \"Ilya Sutskever\")", "minLength": 1 }, "limit": { "type": "integer", "minimum": 1, "maximum": 30, "description": "Number of results (1-30, default 10)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "dblp.cs.search", "title": "Search CS Papers", "description": "Search 7M+ computer science publications on DBLP by title, keyword, or topic. Returns title, authors, venue (NeurIPS, ICML, CVPR, ACL, etc.), year, DOI. The largest CS-specific bibliography \u2014 covers journals, conferences, and workshops (DBLP, CC0)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search query \u2014 paper title, keyword, or topic (e.g. \"transformer attention\", \"graph neural network\", \"LLM reasoning\")", "minLength": 1 }, "year": { "type": "integer", "description": "Filter by publication year (e.g. 2024)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 20)" } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "tides.noaa.predictions", "title": "Tide Predictions", "description": "Get tide predictions for a NOAA station \u2014 high/low tides, hourly, or 6-minute intervals. Returns predicted water level in feet or meters. Covers US coastlines, rivers, Great Lakes. Station IDs: 8518750 (NYC), 9414290 (SF), 8443970 (Boston) (NOAA, US Gov)", "inputSchema": { "type": "object", "properties": { "station": { "type": "string", "description": "NOAA station ID (e.g. \"8518750\" for The Battery NYC, \"9414290\" for San Francisco, \"8443970\" for Boston)", "minLength": 1 }, "begin_date": { "type": "string", "description": "Start date in YYYYMMDD format (e.g. \"20260409\")" }, "end_date": { "type": "string", "description": "End date in YYYYMMDD format (e.g. \"20260410\"). Max range: 31 days." }, "interval": { "type": "string", "enum": [ "hilo", "h", "6" ], "description": "Prediction interval: \"hilo\" = high/low tides only (default), \"h\" = hourly, \"6\" = every 6 minutes" }, "datum": { "type": "string", "description": "Vertical datum: MLLW (default), MSL, NAVD, MHHW, MHW, MLW, etc." }, "units": { "type": "string", "enum": [ "english", "metric" ], "description": "Units: \"english\" = feet (default), \"metric\" = meters" } }, "required": [ "station", "begin_date", "end_date" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "tides.noaa.water_levels", "title": "Real-Time Water Levels", "description": "Get real-time observed water levels from a NOAA station \u2014 latest reading or recent history. Returns water level in feet or meters with quality flags. Updated every 6 minutes. Covers US coastlines, rivers, Great Lakes (NOAA, US Gov)", "inputSchema": { "type": "object", "properties": { "station": { "type": "string", "description": "NOAA station ID (e.g. \"8518750\" for The Battery NYC, \"9414290\" for San Francisco)", "minLength": 1 }, "date": { "type": "string", "description": "Date filter: \"latest\" (default, most recent reading), \"today\", \"recent\" (last 72 hours), or YYYYMMDD for specific date" }, "datum": { "type": "string", "description": "Vertical datum: MLLW (default), MSL, NAVD, MHHW, MHW, MLW, etc." }, "units": { "type": "string", "enum": [ "english", "metric" ], "description": "Units: \"english\" = feet (default), \"metric\" = meters" } }, "required": [ "station" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "met.art.details", "title": "Artwork Details", "description": "Get full details for a Met Museum artwork by object ID \u2014 title, artist, date, medium, dimensions, department, culture, provenance, high-res image URLs, public domain status. Use met.search to find object IDs first (Met Museum, CC0)", "inputSchema": { "type": "object", "properties": { "object_id": { "type": "integer", "description": "Met Museum object ID (e.g. 436524 for Van Gogh Sunflowers, 45734 for Washington Crossing the Delaware). Use met.search to find IDs.", "minimum": 1 } }, "required": [ "object_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "met.art.search", "title": "Search Met Museum Artworks", "description": "Search 470,000+ artworks at The Metropolitan Museum of Art by keyword, artist, medium, department, date range, or geography. Returns object IDs \u2014 use met.details for full metadata and images. CC0 public domain (Met Museum)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search keyword \u2014 artist, title, medium, or subject (e.g. \"monet\", \"sunflowers\", \"greek vase\", \"armor\")", "minLength": 1 }, "department_id": { "type": "integer", "description": "Department filter: 1=American Decorative Arts, 3=Ancient Near Eastern Art, 6=Asian Art, 9=Drawings and Prints, 11=European Paintings, 13=Greek and Roman Art, 17=Medieval Art, 21=Modern Art" }, "medium": { "type": "string", "description": "Medium filter (e.g. \"Paintings\", \"Sculpture\", \"Photographs\", \"Ceramics\")" }, "has_images": { "type": "boolean", "description": "Only return artworks with images (default: true)" }, "geo_location": { "type": "string", "description": "Geographic location filter (e.g. \"France\", \"Japan\", \"Egypt\")" }, "date_begin": { "type": "integer", "description": "Start year for date range filter (e.g. 1800). Use with date_end." }, "date_end": { "type": "integer", "description": "End year for date range filter (e.g. 1900). Use with date_begin." } }, "required": [ "query" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "rijks.art.details", "title": "Rijksmuseum Artwork Details", "description": "Get full details for a Rijksmuseum artwork by object ID \u2014 title (multiple languages), object number, creation date, production location, materials, dimensions, current gallery location. Linked Art JSON-LD format (CIDOC CRM). Use rijks.search to find object IDs first (Rijksmuseum, CC-BY)", "inputSchema": { "type": "object", "properties": { "object_id": { "type": "string", "description": "Rijksmuseum numeric ID (e.g. \"200107928\" for The Night Watch). Use rijks.search to find IDs.", "minLength": 1 } }, "required": [ "object_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "rijks.art.search", "title": "Search Rijksmuseum Collection", "description": "Search 800,000+ artworks at the Rijksmuseum (Dutch national museum) by title, description, creation date, or object number. Returns Linked Open Data object IDs \u2014 use rijks.details for full metadata. Covers Rembrandt, Vermeer, Van Gogh, and centuries of Dutch art. CC-BY license (Rijksmuseum)", "inputSchema": { "type": "object", "properties": { "title": { "type": "string", "description": "Artwork title search (e.g. \"Night Watch\", \"Self-portrait\", \"Milkmaid\")" }, "description": { "type": "string", "description": "Search within artwork descriptions (e.g. \"portrait\", \"landscape\")" }, "creation_date": { "type": "string", "description": "Filter by creation year or date (e.g. \"1642\", \"1665\")" }, "object_number": { "type": "string", "description": "Rijksmuseum object number (e.g. \"SK-C-5\" for Night Watch)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "cma.art.details", "title": "CMA Artwork Details", "description": "Get full details for a Cleveland Museum artwork by ID \u2014 title, artist, nationality, date, medium, dimensions, culture, provenance, license status (CC0/restricted), image URLs (web + full resolution). Use cma.search to find artwork IDs first (CMA, CC0)", "inputSchema": { "type": "object", "properties": { "artwork_id": { "type": "integer", "description": "Cleveland Museum artwork ID (e.g. 135382 for Monet \"The Red Kerchief\"). Use cma.search to find IDs.", "minimum": 1 } }, "required": [ "artwork_id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "cma.art.search", "title": "Search Cleveland Museum Collection", "description": "Search 64,000+ artworks at the Cleveland Museum of Art by keyword, artist, type, or department. Filter for CC0-only (commercial-free) images. Returns artwork IDs, title, artist, date, license status, image URLs. Use cma.artwork for full details (CMA, CC0)", "inputSchema": { "type": "object", "properties": { "query": { "type": "string", "description": "Search keyword \u2014 artist, title, subject (e.g. \"monet\", \"armor\", \"japanese\")" }, "type": { "type": "string", "description": "Artwork type filter (e.g. \"Painting\", \"Sculpture\", \"Print\", \"Photograph\")" }, "department": { "type": "string", "description": "Department filter (e.g. \"European Painting and Sculpture\", \"Asian Art\", \"Prints\")" }, "artist": { "type": "string", "description": "Artist name filter (e.g. \"Claude Monet\", \"Pablo Picasso\")" }, "cc0_only": { "type": "boolean", "description": "Only return CC0-licensed artworks (free for commercial use). Default: false." }, "has_image": { "type": "boolean", "description": "Only return artworks with images (default: true)" }, "limit": { "type": "integer", "minimum": 1, "maximum": 50, "description": "Number of results (1-50, default 20)" } } }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "smithsonian.collection.record", "title": "Smithsonian Record Details", "description": "Get full record for a Smithsonian Open Access item by ID \u2014 title, unit code (which of 19 museums), license (CC0 flag), record_link (canonical URL), data_source, online media (images/audio/video), freetext metadata, indexed structured fields. Use smithsonian.search to find IDs first (Smithsonian, CC0 subset)", "inputSchema": { "type": "object", "properties": { "id": { "type": "string", "description": "Smithsonian record ID from a previous search result (e.g. \"edanmdm-nmnhvz_5068559\" or \"ld1-*\"). Use smithsonian.search first to find IDs.", "minLength": 1 } }, "required": [ "id" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } }, { "name": "smithsonian.collection.search", "title": "Search Smithsonian Collections", "description": "Full-text search across 11M+ records from 19 Smithsonian museums \u2014 art, artifacts, scientific specimens, archives. Filter by type (objects/species/archives/books/online_media/events/places), sort by relevancy/newest/updated/random, and CC0-only by default. Covers National Museum of Natural History, Air and Space, American Art, Portrait Gallery, Freer|Sackler, and more (Smithsonian Open Access, CC0 subset)", "inputSchema": { "type": "object", "properties": { "q": { "type": "string", "description": "Full-text search query. Example: \"dinosaur\", \"picasso\", \"apollo 11\". Supports EDAN query syntax (field:value, AND/OR).", "minLength": 1 }, "rows": { "type": "integer", "minimum": 1, "maximum": 100, "description": "Number of results to return (1-100, default 10)." }, "start": { "type": "integer", "minimum": 0, "description": "Offset for pagination (default 0). Useful with rowCount from previous call." }, "sort": { "type": "string", "enum": [ "relevancy", "newest", "updated", "random" ], "description": "Sort order for results. Default: relevancy." }, "type": { "type": "string", "enum": [ "archives", "books", "online_media", "objects", "events", "places", "species" ], "description": "Filter by record type. E.g. \"objects\" for 3D objects, \"species\" for scientific specimens." }, "online_media_type": { "type": "string", "enum": [ "Images", "Sound recordings", "Videos" ], "description": "Filter to items that have media of a specific type." }, "cc0_only": { "type": "boolean", "description": "Filter results to CC0-licensed records only (default true). Set false to include all records with their license field." } }, "required": [ "q" ] }, "annotations": { "readOnlyHint": true, "destructiveHint": false, "idempotentHint": true, "openWorldHint": true } } ], "prompts": [ { "name": "discover-tools", "description": "Find the right APIbase tools for a task. Describes available categories, search strategies, and tool selection criteria.", "arguments": [ { "name": "task", "description": "What you want to accomplish (e.g. \"find flights from NYC to London\")", "required": true } ] }, { "name": "api-workflow", "description": "Design a multi-step API workflow combining multiple APIbase tools. Returns execution plan with tool sequence, data flow, and error handling.", "arguments": [ { "name": "goal", "description": "End-to-end goal (e.g. \"plan a trip to Tokyo with flights, weather, and local events\")", "required": true }, { "name": "budget", "description": "Optional USDC budget constraint for the workflow", "required": false } ] }, { "name": "x402-payment-guide", "description": "Explains x402 USDC micropayment flow for APIbase. Covers wallet setup on Base, payment headers, escrow mechanics, and refund policy.", "arguments": [ { "name": "topic", "description": "Specific payment topic (e.g. \"setup\", \"escrow\", \"refunds\", \"pricing\")", "required": false } ] } ], "resources": [ { "name": "tool-catalog", "description": "Full tool catalog with schemas, pricing, and provider info", "uri": "https://apibase.pro/api/v1/tools" }, { "name": "health-status", "description": "System health check", "uri": "https://apibase.pro/health/ready" } ] }